Identifiers and Description

Gene Model Identifier

SteCoe_25370

Standard Name

None

Aliases

None

Description

tRNA-synt_2c domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17366.0.g580tRNA synthetases class II (A)

Saccharomyces CerevisiaeYOR335C0.00000000000009357622968840175Cytoplasmic and mitochondrial
alanyl-tRNA synthetase; requir
ed for protein synthesis; poin
t mutation (cdc64-1 allele) ca
uses cell cycle arrest at G1;
lethality of null mutation is
functionally complemented by h
uman homolog AARS; mutations i
n human homolog AARS are assoc
iated with autoimmune disease
polymyositis/dermatomyositis
WormBaseWBGene000001960.00000000027894680928689246

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25370(Protein)
MESDTIKTLTAKEMKNLAKPEFAKNPDQFYPTKVFSKFGFSRAQCKKCHANFWRHVETKE
TCGDSNCEGSYKFIGVGTGKGRKGNKITYAEAWQGFMKSFTSARIPCTAIERYPVVARWR
NDVEYVAAGIYCFQPYCVTGEMEPPANPLICPQFCVRFNDLDNIGLTGRHYSGFIMLGIQ
VFNLPNKYIFFKEECVEWFNDLDNIGLTGRHYSGFIMLGIQVFNLPNKYIFFKEECVEFN
LRWLIEELEIDPDEITLIEDVWAGGGNLGPCVEYFIGGLEVGNMVFMQFKTFPDGSREEL
PVKIIDTGIGLERIPWLINGTPTSYMDVFRHAFTWLSEKLNIQVNTEVWEKFGPLSCRLN
IDEVDDIDKTWKEISELINIPVETVKNAIAPIKDMYIVLDHTRSVLLIVEDGSLPSNVGG
GANVRNILRRVFALLKKNSWWDKLGMDGLIELFQKHKDDLRGIYGEFKEYKSFRSIIEVE
YERWIQTDKDQKDRLSKLITKSKGKLTIEDWIIAITSWGIPADRVHEISGIPPPGDLYYQ
IAYRQEQMTKAPESILYDTTHLTETVNLYYADHKMMKFTSKVIEVLSNITQAGIKNIVIL
AESAFYPISGGQANDTGNMVINGVTYEVKEVEKIGRCVLHILDRAVEGDIIGAEVQGNID
EDRRKQLRNHHTATHIVFAACRKVLGPHVWQNGAKKTVEVAHLDITHYRSLTHEEELAIE
NAANRIVSSCTNINKSFMNKAEAEIEYGFSLYQGGIVPGNNLRVVNIEGVDTEACCGTHC
DNTAEVGRIRLLKSHRISDGIVRLNYVAGEKALVKLNEEDGILYHLCKLWGISLPEIVPT
AERFFQGYKKLEETARKQQEKILALTVKSILCDPGYTLALLNSDQANPTLYFSFLKEHAE
NLKNTGKGVIFVGNNFLYGLLGKKELLDVNGLLNVLKKNNAEAKIKAQEKLQVKKGKGKP
MTIEGAVEFSYIGSYTQEVKDFLFAAGFKLFE


>SteCoe_25370(CDS)
ATGGAAAGTGATACCATCAAAACACTGACTGCTAAGGAAATGAAAAACCTGGCTAAGCCT
GAGTTTGCCAAGAATCCAGACCAGTTTTATCCAACTAAAGTCTTCTCTAAGTTCGGTTTC
TCACGAGCCCAATGCAAAAAGTGCCACGCAAATTTCTGGAGACATGTCGAGACTAAAGAG
ACTTGTGGGGACTCAAACTGTGAAGGATCTTATAAATTCATAGGTGTTGGGACTGGCAAG
GGCCGAAAAGGTAACAAAATCACCTATGCTGAAGCTTGGCAAGGGTTCATGAAATCCTTC
ACTTCAGCAAGAATTCCTTGTACGGCTATAGAAAGATACCCTGTTGTAGCCCGTTGGCGT
AATGATGTCGAATATGTAGCTGCAGGAATTTATTGTTTTCAACCATATTGTGTCACTGGA
GAAATGGAACCTCCAGCCAACCCTTTAATTTGCCCTCAATTTTGTGTTAGGTTTAATGAC
TTAGACAACATCGGTTTAACCGGCCGTCATTATTCTGGGTTCATTATGTTAGGTATCCAA
GTGTTTAATTTACCAAACAAGTACATTTTTTTCAAAGAAGAATGTGTGGAATGGTTTAAT
GACTTAGACAACATCGGTTTAACCGGCCGTCATTATTCTGGGTTCATTATGTTAGGCATC
CAAGTGTTTAATTTACCAAACAAGTACATTTTTTTCAAAGAAGAATGTGTGGAATTTAAC
TTAAGATGGCTTATTGAAGAGTTAGAAATTGATCCAGATGAAATCACTTTAATTGAAGAT
GTTTGGGCTGGTGGGGGGAATCTTGGTCCTTGTGTTGAGTATTTTATTGGAGGTTTAGAA
GTTGGTAATATGGTTTTTATGCAATTTAAAACCTTCCCTGATGGGTCTAGAGAAGAACTT
CCAGTTAAAATTATAGATACTGGTATTGGCCTTGAAAGAATTCCTTGGCTTATTAATGGT
ACACCTACAAGTTATATGGATGTTTTTAGACATGCTTTTACATGGTTGTCAGAAAAACTT
AATATACAAGTTAATACAGAAGTATGGGAAAAGTTTGGCCCATTGTCTTGTAGATTGAAT
ATTGATGAAGTTGATGATATTGACAAGACTTGGAAAGAAATTTCTGAACTTATAAACATT
CCTGTTGAGACTGTTAAGAATGCTATAGCGCCTATTAAAGATATGTATATTGTTTTAGAT
CATACAAGAAGTGTTTTGTTGATTGTTGAAGATGGATCTTTGCCTTCAAATGTGGGTGGC
GGGGCTAATGTGAGGAATATTTTACGTAGGGTTTTTGCTTTGCTTAAGAAAAATTCTTGG
TGGGATAAACTTGGAATGGATGGGCTTATTGAGTTGTTCCAAAAGCATAAAGATGATCTT
AGAGGTATATATGGAGAGTTTAAAGAATATAAAAGCTTTAGGTCTATAATTGAAGTTGAA
TATGAAAGGTGGATTCAGACTGACAAGGATCAAAAAGACCGTCTTTCTAAGCTTATAACA
AAAAGTAAAGGGAAACTTACAATAGAAGATTGGATTATCGCTATAACTTCATGGGGAATC
CCAGCTGACCGTGTTCATGAAATATCAGGAATTCCTCCTCCTGGAGATTTATACTATCAA
ATTGCTTATCGTCAAGAGCAGATGACTAAAGCTCCTGAATCTATATTATATGACACAACA
CATTTGACTGAAACTGTGAATTTATATTATGCTGACCATAAAATGATGAAATTTACAAGT
AAAGTTATTGAGGTATTAAGCAATATTACACAGGCAGGGATTAAAAACATTGTAATTTTA
GCCGAAAGTGCTTTTTATCCTATTTCAGGTGGACAGGCTAATGATACTGGGAATATGGTG
ATTAATGGAGTGACTTATGAAGTTAAAGAAGTCGAAAAAATAGGTCGTTGTGTTTTACAT
ATATTAGATAGAGCTGTAGAAGGAGATATTATTGGTGCTGAAGTTCAAGGGAATATCGAT
GAAGATAGAAGAAAACAGCTTAGAAATCATCATACTGCAACACATATAGTTTTTGCTGCT
TGTAGAAAAGTATTAGGACCTCATGTATGGCAAAATGGTGCTAAAAAAACTGTTGAAGTA
GCTCATTTAGATATAACTCATTATCGTTCTTTAACTCACGAAGAAGAATTAGCTATTGAA
AACGCAGCTAATCGTATTGTATCAAGTTGTACCAATATCAACAAATCTTTTATGAATAAA
GCTGAAGCTGAAATTGAATATGGATTTTCTCTTTATCAAGGAGGTATCGTTCCAGGGAAT
AATCTTCGTGTTGTAAATATTGAAGGTGTTGATACTGAAGCTTGTTGTGGTACTCATTGT
GATAATACTGCTGAAGTAGGGCGTATACGTCTTCTTAAGTCTCATAGGATATCTGATGGT
ATTGTCCGTTTAAACTATGTCGCTGGGGAAAAAGCTCTAGTTAAACTTAATGAAGAAGAT
GGGATTTTATATCATTTATGTAAACTCTGGGGTATTTCCTTACCTGAAATTGTCCCAACA
GCTGAGAGGTTCTTCCAAGGATATAAAAAACTTGAAGAAACAGCAAGGAAACAACAAGAA
AAAATCTTAGCTTTGACTGTTAAAAGTATACTATGTGATCCTGGGTATACTTTAGCTTTA
TTGAATAGTGATCAAGCTAATCCAACTCTTTATTTCTCGTTTTTGAAAGAACATGCTGAG
AACTTGAAAAATACAGGAAAAGGGGTGATATTTGTTGGGAACAACTTTTTGTATGGACTT
TTAGGGAAAAAAGAGCTTCTTGATGTTAATGGATTATTGAATGTTCTGAAGAAAAACAAT
GCTGAGGCTAAGATTAAGGCTCAGGAGAAACTACAGGTGAAAAAAGGTAAGGGAAAACCT
ATGACAATTGAAGGAGCTGTGGAGTTTAGTTATATTGGGAGCTATACTCAAGAAGTGAAA
GACTTTTTATTTGCCGCTGGGTTTAAGCTTTTTGAGTAA