Identifiers and Description

Gene Model Identifier

SteCoe_25459

Standard Name

None

Aliases

None

Description

DnaJ domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5723.0.g861.5007857627073948e-41Sec63 Brl domain

WormBaseWBGene000010471.7587922024243116e-25
Tetrahymena ThermophilaTTHERM_004430104.780892883885469e-25DnaJ domain containing protein
Saccharomyces CerevisiaeYOR254C0.000000000005109089028063325Essential subunit of Sec63 com
plex; with Sec61 complex, Kar2
p/BiP and Lhs1p forms a channe
l competent for SRP-dependent
and post-translational SRP-ind
ependent protein targeting and
import into the ER; other mem
bers are Sec62p, Sec66p, and S
ec72p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25459(Protein)
MSGFKETFTKEEGGEKNLDYDDSAFFYFAAVLEIVILLPLIFSFIKNKILGYEKKEKLSL
KNLDINTHHCPCSICAGKRAFHITPESASQKFGFGGIFQLLLISFLCYLLYITILSISES
PQGIKRFDPYEILGIEIGATDKQIRSAFREMSKIYHPDKNIGNNWAAGKYLQITRAYETL
TNELAKSNYERYGNPDGPSSIRFAIGLPRFLLKTENHISILIVFFIIILIVIPGSVLFWI
NTSKRFDKNGVLQENAGLYARVLNENLQIKHCLFMVAISLEFQDINAPKSESGELAKLRN
RYLEHIPKRQNINPRILKVMLLLLAHMDRREVSETLKKDTIMIISKAVNMIETMLDASYM
LNLMQKTKKMSIRTFTLLIEFSQLLTQGLMLHDSNVLMLPKIDESLLKFLGNKKKPKISE
LKDNDDFKKIQEKLSPEAFEDFKVVLNYLPELKVTAEAYVDGEEGISEGDLVSVKFTIER
LTLKEGQKQGIAHSSFFPLLRLEKLWIILADPIANKVYYLKSIQSCDKIIEDKDFKFPIG
PNAINIGVGKHKWEVHVKSDCYYGLDVVIPLEFEVLPTSQIKKDIFVHPDDQKIEKQTTW
IQQVMSGLQAEESSEEEMPELEEGLESKELEDIIDS


>SteCoe_25459(CDS)
ATGTCTGGATTTAAAGAAACCTTCACAAAGGAAGAAGGAGGTGAAAAGAATCTAGACTAT
GACGACTCAGCTTTCTTTTATTTTGCTGCAGTATTAGAAATAGTTATACTCCTGCCTCTA
ATTTTCTCTTTTATCAAAAACAAAATCCTAGGGTATGAAAAGAAAGAAAAACTCTCTCTA
AAAAACCTTGATATTAACACCCATCATTGTCCTTGTTCAATCTGTGCTGGAAAACGAGCT
TTCCATATAACCCCAGAGTCAGCATCACAGAAATTCGGTTTTGGGGGCATTTTCCAGTTG
CTTCTTATATCATTTCTATGTTACTTACTCTATATAACAATATTAAGTATTTCTGAGTCT
CCACAAGGTATAAAACGCTTTGATCCATATGAAATTCTTGGTATTGAAATTGGAGCAACA
GATAAACAAATCCGTTCAGCTTTCAGAGAAATGAGTAAAATCTACCATCCAGATAAAAAC
ATAGGAAACAATTGGGCTGCTGGGAAATATTTACAAATAACCAGAGCTTATGAAACTTTA
ACTAATGAATTGGCTAAGAGTAATTATGAAAGATATGGAAACCCAGATGGACCTAGTTCT
ATAAGATTTGCTATTGGTTTACCAAGGTTTCTTTTAAAAACAGAAAACCATATATCAATT
CTTATTGTGTTTTTTATTATAATACTTATAGTTATTCCTGGAAGTGTATTGTTTTGGATA
AATACATCAAAAAGATTCGATAAGAATGGAGTTTTACAAGAAAATGCTGGACTTTATGCT
AGAGTACTTAATGAAAATTTACAGATAAAACATTGTTTATTTATGGTTGCAATAAGCCTT
GAGTTTCAAGATATTAATGCTCCAAAATCTGAATCTGGAGAACTTGCTAAATTAAGGAAT
AGATATTTGGAACATATACCTAAAAGACAGAATATAAATCCAAGAATATTAAAAGTTATG
TTATTACTTTTGGCTCATATGGATAGAAGAGAAGTTAGTGAAACATTAAAGAAAGATACA
ATAATGATTATATCTAAAGCTGTAAACATGATAGAGACAATGTTAGATGCTTCTTATATG
CTAAATCTTATGCAGAAAACTAAGAAAATGAGTATTAGGACATTTACTTTACTTATAGAG
TTTTCTCAATTATTAACTCAAGGATTGATGTTACATGATAGTAATGTGCTTATGCTACCT
AAAATTGATGAGTCTTTACTGAAATTCCTTGGGAATAAGAAAAAACCTAAGATTTCTGAA
CTTAAAGATAATGACGATTTCAAGAAAATTCAAGAAAAACTCAGCCCTGAAGCTTTTGAA
GATTTTAAAGTTGTGTTAAATTATTTACCTGAACTTAAAGTTACAGCTGAAGCATATGTT
GATGGAGAAGAAGGAATTAGTGAAGGTGATTTAGTTAGTGTAAAATTTACTATTGAAAGA
CTAACATTAAAAGAAGGACAGAAACAAGGAATTGCCCATTCAAGCTTTTTCCCATTGTTA
AGATTAGAAAAACTTTGGATTATTTTAGCTGACCCTATAGCTAATAAAGTATATTACTTA
AAATCAATACAAAGTTGTGATAAAATTATTGAAGATAAAGATTTTAAGTTCCCAATTGGA
CCTAATGCTATTAATATTGGTGTTGGAAAACATAAATGGGAAGTTCATGTGAAATCTGAT
TGTTATTATGGTTTAGATGTTGTGATTCCTTTAGAATTTGAAGTCCTTCCAACTTCACAG
ATTAAAAAAGATATTTTTGTACATCCTGATGACCAGAAAATTGAAAAGCAAACCACTTGG
ATACAACAAGTTATGAGTGGATTGCAAGCTGAAGAATCTTCGGAAGAAGAAATGCCAGAA
CTTGAAGAAGGGCTGGAATCGAAAGAACTCGAAGATATAATAGATAGTTAA