Identifiers and Description

Gene Model Identifier

SteCoe_25506

Standard Name

None

Aliases

None

Description

MIT domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13722.0.g1022.001470128041443e-75ATPase family associated with
various cellular activities (A
AA)

Saccharomyces CerevisiaeYPR173C8.074506789675094e-73AAA-ATPase involved in multive
sicular body (MVB) protein sor
ting; ATP-bound Vps4p localize
s to endosomes and catalyzes E
SCRT-III disassembly and membr
ane release; ATPase activity i
s activated by Vta1p; regulate
s cellular sterol metabolism
WormBaseWBGene000213343.917469664450395e-64
Tetrahymena ThermophilaTTHERM_009894903.1743585474772134e-60ATPase, AAA family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25506(Protein)
MSNDEIRKKAIDIAKRAVEEDRKSNLEEAYNLYKQAIKYFIHIQKYEQNPILKNSFSEKL
NEYLKRAEEISNFLHNEEAPQPVLSGGVKQAAKKKGEEGKGDKDDDANAGLKKSLESAII
TEKPNVKWTDVAGLANAKQILQEAVILPTRFPELFVGKVRPWKGILLYGPPGTGKSYLAK
ACATEASGTFFSVSSSDLVSKFMGESERLVRSLFEMARKSLPAIIFIDEIDSLCGSRSEG
ENDATRRIKTEFLVQMQGVGHTDDGLLVLGATNIPWELDPAIRRRFERRVYIPLPEEFAR
RKLFELNIGDTPNDLTDEDYDELARLTEGSSGSDISTVVKSALMEPIRKCQSAKYYKVIM
EEGKQKYTPCAPSDPAGREMNLMDVPKGCLKPPKICAEDFFSILSSTKPSVSQADLVKQQ
QFTEEFGMEG


>SteCoe_25506(CDS)
ATGTCAAACGATGAAATTCGAAAAAAAGCTATCGACATTGCCAAGCGAGCCGTAGAAGAA
GATCGTAAATCTAACCTCGAAGAAGCTTATAACCTTTATAAACAAGCAATCAAATACTTT
ATTCATATACAAAAATACGAGCAGAATCCAATTCTTAAAAACAGCTTTTCTGAGAAACTA
AATGAGTATCTTAAACGAGCTGAAGAAATATCGAATTTCCTTCATAATGAAGAAGCACCA
CAACCTGTTTTATCAGGAGGGGTAAAACAGGCAGCAAAGAAAAAAGGTGAAGAAGGTAAA
GGGGATAAGGATGATGATGCTAATGCTGGGTTGAAAAAGTCTTTAGAATCAGCGATTATT
ACTGAAAAACCAAATGTTAAATGGACTGATGTGGCTGGACTTGCTAATGCTAAGCAGATT
TTACAGGAAGCTGTGATATTGCCAACACGCTTTCCTGAACTGTTTGTTGGGAAAGTTCGT
CCTTGGAAAGGCATTTTATTATATGGCCCACCTGGAACTGGGAAGTCTTATTTAGCAAAA
GCTTGTGCTACGGAAGCTTCAGGGACTTTTTTTTCAGTATCTTCTAGTGACTTGGTATCT
AAGTTTATGGGTGAATCTGAAAGATTAGTTAGGTCATTGTTTGAAATGGCTAGAAAAAGC
TTGCCAGCAATTATTTTCATTGATGAAATCGACTCGTTGTGCGGCAGTCGTAGTGAAGGT
GAAAATGATGCGACTAGAAGAATTAAAACTGAGTTTCTTGTTCAAATGCAAGGTGTTGGA
CACACTGATGATGGACTTCTGGTACTTGGGGCAACAAATATTCCATGGGAACTAGACCCA
GCTATAAGACGTCGTTTTGAAAGGCGTGTTTATATTCCTCTTCCTGAAGAATTCGCAAGA
CGCAAACTTTTTGAGTTGAATATAGGCGATACTCCAAACGATCTTACAGATGAGGACTAT
GATGAATTGGCTCGGTTAACAGAAGGGTCTTCAGGTTCTGATATTTCAACAGTTGTGAAA
TCAGCATTAATGGAGCCAATAAGAAAATGCCAATCAGCAAAATACTATAAAGTTATCATG
GAAGAAGGAAAGCAAAAATATACACCTTGTGCCCCTAGTGATCCAGCAGGAAGAGAAATG
AATTTAATGGATGTTCCTAAAGGATGCTTGAAGCCACCAAAGATCTGTGCTGAAGATTTC
TTTAGTATTCTTAGCTCTACTAAACCTTCTGTATCGCAAGCAGACTTGGTTAAACAACAA
CAATTTACTGAAGAATTTGGTATGGAAGGATAA