Identifiers and Description

Gene Model Identifier

SteCoe_25774

Standard Name

None

Aliases

None

Description

Adaptin_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20452.0.1.g170Adaptin N terminal region

Tetrahymena ThermophilaTTHERM_003160108.074506789675094e-73Adaptin complex 4 (AP-4) epsil
on subunit
WormBaseWBGene000001581.7587922024243116e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25774(Protein)
MSSGSHLSKELFDLVKSIGESKSKQEEDKIITQEVINLKTKISEPGIPIKKMKEMLIRAI
YIEMLGHDSSFAYIHAINMTNCPSVAAKRVGYVTCALCLPSESPMLILLVANLQRDLQSS
NYLEVSAALTAVCKLVNAGFLHAFSDQIVRLTTHTHELIRKKAVMVLSRFIKVSPSQASE
YIPIFRKMLCDRDPSVMGASLNAFAELLKDPENVPLFKDIITSFIAILRQINEHRLPRDF
DYHKMPAPWIQIRILEILARLGEGDKRASDQMHDAISEVMRRADEIGDNIGYALVYQCMK
TITQIYPHPPLIESAAQLVSRFLTAGDNNLKYTGITGLISIVKINPKYSLKHQMIVVDCL
EDPDETLKRKTLSLLYKMCSATNIKVIIEKLNNELKSLAYDFHLKQEIVSQITELAEKFA
PDSKWYTKTMIEMFENASDFIRPSIVNSLVRLVDEWREDSVLIQFTVNEYYNVLKNYNNI
PDCLMQVTAWVLGEFGDMLVGERHEETVILLCRSLFKRFEDSLTKGWILTAVQKLNKGIP
SEMCRDYISRFATSRNEDLQQRCYEFANVVTKLSSPLAFRNNQSLVVDFEFLNPYIQQQV
VRGAKMYNPERNRKGLGFLIHKTRNDEYKASEALQSMRLVPYSAPTLQEKYVPRAQESQP
VTSELQVRAKAWSTQGYQGTNQGFSSSSGSGSFGSGFSSNPSTGFSSNPSSGFSSNPSSG
FSSNPSSGFSSNPSSGFSSNPSSGFSSNPSSSFSNNPGFSSNSGLGYSTGNFQEAPRFSN
PVSQSFKQPKSKFMKTEKELAKEAFAQNLFGGVEQTEQPKPQTRPAPPQPVQKPLENLLD
F


>SteCoe_25774(CDS)
ATGTCCTCTGGTAGTCACTTATCCAAAGAACTATTTGACCTAGTCAAATCTATTGGTGAG
TCTAAAAGCAAGCAGGAAGAAGACAAAATTATCACTCAAGAAGTTATCAACTTAAAGACA
AAAATATCTGAGCCTGGAATACCAATCAAGAAAATGAAAGAAATGCTTATTAGAGCAATT
TATATTGAAATGCTCGGACACGATTCATCCTTTGCTTATATTCACGCGATTAATATGACA
AACTGTCCAAGTGTTGCTGCAAAAAGAGTAGGTTATGTAACTTGTGCATTATGCCTACCT
TCTGAAAGCCCAATGCTAATATTGCTAGTTGCTAACCTTCAAAGAGACCTACAAAGCTCT
AATTACTTAGAAGTCTCTGCAGCTCTAACTGCAGTTTGCAAGCTTGTCAATGCAGGGTTT
TTACATGCATTTTCAGATCAGATTGTTCGTTTAACCACTCATACTCATGAACTTATAAGG
AAAAAAGCTGTAATGGTTTTAAGTCGATTTATAAAAGTGTCTCCATCCCAAGCTTCTGAA
TATATTCCTATCTTCCGCAAGATGCTATGTGACAGAGATCCTTCTGTGATGGGGGCTTCG
CTTAATGCATTCGCTGAGCTTCTTAAAGACCCAGAAAATGTCCCACTTTTTAAAGATATC
ATCACATCGTTTATAGCTATACTCAGGCAAATCAATGAACATAGACTTCCTCGAGATTTC
GATTACCACAAAATGCCAGCACCTTGGATACAGATTAGGATATTAGAAATATTAGCAAGA
TTAGGAGAAGGGGACAAGAGAGCAAGTGACCAAATGCATGATGCTATATCAGAAGTTATG
AGAAGAGCTGATGAAATTGGGGATAATATAGGCTATGCTCTTGTATATCAATGTATGAAA
ACAATCACGCAGATTTATCCTCACCCTCCTCTTATAGAAAGTGCTGCTCAGCTTGTGTCA
CGTTTTCTAACAGCTGGGGATAATAATTTAAAGTACACAGGGATCACAGGGCTGATTAGT
ATCGTAAAAATTAACCCAAAATACTCTTTAAAACATCAAATGATTGTAGTTGATTGTCTT
GAAGATCCAGACGAAACATTGAAACGCAAGACTCTTTCACTACTTTATAAAATGTGTAGC
GCCACAAATATCAAAGTCATTATTGAAAAACTTAATAACGAGTTAAAAAGCTTAGCCTAT
GACTTCCATCTTAAACAAGAAATCGTATCTCAAATCACAGAACTAGCTGAGAAATTTGCC
CCAGATTCAAAATGGTACACAAAAACAATGATTGAGATGTTTGAAAATGCTAGTGATTTT
ATAAGACCTAGTATTGTAAATAGCCTAGTGCGTTTAGTTGATGAATGGAGAGAAGATTCA
GTTTTAATACAATTCACGGTTAATGAATATTATAATGTATTGAAGAATTACAACAATATT
CCAGACTGTTTAATGCAAGTGACTGCATGGGTTTTAGGTGAGTTTGGGGATATGTTAGTA
GGTGAACGACATGAAGAAACTGTGATTTTATTATGTCGAAGTTTGTTTAAACGCTTTGAA
GATAGTTTGACTAAAGGGTGGATTTTAACTGCAGTACAGAAACTTAATAAAGGTATTCCT
TCTGAAATGTGTAGGGATTATATTAGCAGATTTGCTACTTCACGTAATGAAGACTTACAG
CAAAGATGCTATGAGTTTGCTAATGTTGTAACAAAACTCAGTAGTCCTTTGGCTTTTAGA
AATAATCAGTCATTAGTTGTGGACTTTGAGTTTTTGAATCCGTATATTCAACAACAAGTT
GTTAGAGGAGCTAAAATGTATAATCCTGAAAGGAATAGAAAAGGACTTGGGTTTCTTATA
CATAAGACAAGAAATGATGAGTATAAAGCTAGTGAAGCACTTCAGTCTATGAGGCTTGTT
CCTTACTCAGCTCCAACTCTTCAAGAAAAGTATGTTCCAAGAGCTCAAGAGTCTCAACCT
GTGACTAGTGAACTTCAAGTTAGGGCTAAGGCATGGTCAACTCAAGGCTATCAAGGGACT
AATCAAGGTTTTTCAAGTAGTTCTGGTTCAGGCAGCTTTGGCTCAGGTTTTTCAAGTAAC
CCCAGTACAGGATTTTCAAGCAATCCTAGTTCAGGCTTTTCAAGTAACCCGAGTTCAGGC
TTTTCAAGTAACCCCAGTTCAGGCTTTTCAAGTAACCCCAGTTCAGGATTTTCAAGTAAC
CCCAGTTCAGGCTTTTCAAGCAATCCTAGTTCAAGTTTTTCAAACAATCCAGGCTTTTCA
AGCAACTCTGGCTTAGGATATTCTACAGGAAATTTTCAAGAAGCACCAAGATTCTCAAAC
CCAGTCTCTCAAAGCTTCAAACAGCCAAAATCAAAATTCATGAAAACAGAAAAGGAACTT
GCTAAAGAAGCCTTTGCCCAAAATCTTTTTGGAGGTGTTGAGCAAACTGAACAGCCTAAA
CCCCAAACTCGTCCCGCCCCACCACAGCCAGTGCAGAAACCACTAGAGAACTTATTAGAT
TTTTAG