Identifiers and Description

Gene Model Identifier

SteCoe_26039

Standard Name

None

Aliases

None

Description

Bromo domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18584.0.g1086.305116760146989e-16Bromodomain

Tetrahymena ThermophilaTTHERM_004834900.00000000000009357622968840175Bromodomain containing protein
Saccharomyces CerevisiaeYGR252W0.000045399929762484854Catalytic subunit of ADA and S
AGA histone acetyltransferase
complexes; modifies N-terminal
lysines on histones H2B and H
3; acetylates Rsc4p, a subunit
of the RSC chromatin-remodeli
ng complex, altering replicati
on stress tolerance; relocaliz
es to the cytosol in response
to hypoxia; mutant displays re
duced transcription elongation
in the G-less-based run-on (G
LRO) assay; greater involvemen
t in repression of RNAPII-depe
ndent transcription than in ac
tivation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26039(Protein)
MNSDETQKALNLVKHLSQMNESIHFLHPVDYRALGLHDYPNIIKTPMDLSTVKSKIKVNH
YNNFDDFLGDMILIWDNCRTYNLAESQIVQQTEILEKSMLRFCNQNNISLENVLKRPKIE
EHPDTVPFQEKVDLSERLKILSAKKLANIVEIIEINCPKAITQLTDERIQLRIDALDKNS
FAKVKEYVFSEKSEDTPTKRIKLEE


>SteCoe_26039(CDS)
ATGAACTCTGATGAAACTCAAAAGGCGCTAAATTTAGTAAAGCATCTTTCTCAAATGAAC
GAAAGTATTCATTTCCTCCATCCTGTCGATTACCGAGCTCTTGGACTTCACGATTATCCC
AACATTATCAAAACCCCTATGGACTTATCAACTGTAAAGTCTAAAATTAAAGTAAATCAT
TACAATAATTTTGATGACTTTTTAGGAGATATGATATTAATATGGGATAACTGTAGAACT
TATAATTTAGCTGAATCTCAAATAGTCCAGCAAACAGAAATATTAGAAAAAAGTATGTTA
AGGTTTTGCAATCAAAACAATATCAGCCTTGAAAATGTACTTAAAAGGCCTAAGATTGAA
GAACACCCTGATACTGTGCCTTTTCAAGAAAAAGTCGACCTTTCTGAAAGGCTAAAAATC
CTTTCAGCTAAAAAATTAGCGAATATTGTGGAAATTATTGAAATAAACTGTCCTAAGGCT
ATAACTCAGTTAACGGATGAGAGGATACAGTTGAGGATTGATGCTTTGGATAAAAACTCA
TTTGCAAAGGTGAAAGAGTATGTTTTTTCAGAGAAATCCGAAGATACTCCAACAAAAAGA
ATTAAACTTGAAGAATAG