Identifiers and Description

Gene Model Identifier

SteCoe_26112

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21142.0.g1013.917469664450395e-64WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_004464301.1677812485237086e-60Intermediate chain subunit of
ciliary two-headed inner arm d
ynein (IAD) complex 1

WormBaseWBGene000159270.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26112(Protein)
MQSTLKAPSGAKVPIASSKKLPVATGTMKNAATGKQGTGTTKKTKGKFSTTGTNQTDGRE
IIIENGKEQDVTPDPLIFTPEEVKQEKKEESDKSSVKVASNTSDKKDEAPTGSFSRGERS
DLVMSSVLKSSDQSEVYSEVSDDTGKERITDVPKVEDKGIRDEDLDKYIDIDLKETETFT
VFWIPSIAISAKAENKEEFDKINASYKNLLNEKIGSDNFKSRPSQTLNLMQKNKDVVTET
IKKHEFECDVTNWMLHDAFLENPKPNHELVANMFEQEVKANLTDQLKNKGTLLDPEKSLT
DTYHSVSVSQSQVTNKEKETTNSKVRSSKRIDKSNHSVHSNSSITQSKHSQGSGKQEPEV
TPFKAPENIILPDSLLTKFNIVERILTQNRYLEQQILYRNYPTVEFQKVVEEEKQQEKGA
LSRFAMLQVKKESEKKEEVKDDIDKDSPHMIDLFKYTCSEVTDRLVSCADWNGPNPDLLA
VSYGEYNFLAEKAQSGKPYLDKPGLLLFWTLKSPKFPERIIRAPSGIVSCHFSKKNPWLI
ATGSCDGVVSIYDLRKKGDKPAAESSQMIEKHIDTVWEVKWHDQGSENGENLISISSDGR
IVEWSIKKGLECRDLLNLKKPTNPNQKDDKEAAVFRNSVGFSLDFPKDQYMLYLASTEEG
TIHKCSLSYNDELDTYWGHSGPVYKVRCSPFWSNIMLTCSADWTVQVWDWRRDESPLFAC
RSQDLNDAVNDIEWSPHSSTIFSNVCDDGRVELWDLSVSNIGPIITKKPENRSSPGTMVR
FCQEFPVLVTGNSQGVVDVYRLKNLNQELLTKDEHKKRLEKAVYPIERSGYHKGEDEEEE
MEGIVD


>SteCoe_26112(CDS)
ATGCAGTCTACATTAAAAGCTCCAAGTGGGGCTAAAGTGCCGATAGCAAGTTCAAAAAAA
CTGCCAGTTGCCACTGGGACAATGAAAAATGCAGCAACAGGCAAGCAAGGTACAGGCACA
ACAAAAAAAACAAAGGGTAAATTTAGCACTACAGGGACAAATCAAACTGATGGAAGAGAA
ATAATCATAGAAAACGGAAAAGAACAAGACGTTACTCCAGACCCTCTTATTTTCACTCCT
GAAGAAGTTAAGCAGGAAAAAAAAGAAGAGTCCGATAAAAGTTCAGTAAAAGTTGCATCA
AACACTTCAGATAAAAAAGACGAAGCTCCAACAGGTTCATTTTCACGAGGTGAAAGATCT
GATTTAGTAATGAGTTCAGTCTTAAAAAGTTCAGATCAAAGTGAAGTTTATTCTGAAGTA
TCAGATGATACAGGGAAAGAACGTATAACTGATGTGCCTAAAGTTGAAGATAAAGGTATC
CGTGATGAAGATCTAGATAAATATATCGATATCGACCTTAAAGAAACTGAAACTTTCACA
GTATTCTGGATTCCATCAATAGCCATAAGCGCTAAAGCTGAAAACAAAGAAGAATTCGAT
AAAATAAACGCATCTTATAAAAACCTTCTAAATGAAAAAATCGGTAGCGACAACTTCAAA
TCAAGACCATCCCAAACCTTAAACCTCATGCAAAAAAACAAAGACGTCGTCACAGAAACT
ATAAAAAAACATGAATTTGAATGCGATGTGACGAACTGGATGCTCCACGATGCATTTTTA
GAAAACCCAAAACCTAATCATGAACTAGTAGCCAATATGTTTGAACAAGAAGTCAAAGCT
AATTTAACAGATCAACTAAAAAATAAAGGGACTTTATTAGATCCTGAAAAAAGTTTAACT
GATACTTATCATAGTGTAAGTGTATCACAAAGCCAAGTTACTAATAAAGAAAAAGAAACG
ACAAATTCTAAGGTTAGATCATCAAAACGTATAGATAAATCAAATCATAGTGTACATTCA
AATTCTTCAATTACCCAATCAAAACATTCACAAGGGTCAGGGAAACAGGAACCTGAAGTT
ACTCCATTTAAAGCTCCGGAAAATATTATTTTACCTGATAGTCTGTTGACTAAGTTTAAT
ATTGTTGAGAGGATTTTAACGCAAAATCGATATTTGGAACAACAGATTTTGTATAGAAAC
TATCCTACGGTAGAATTTCAGAAAGTTGTTGAGGAGGAAAAACAGCAAGAAAAAGGTGCT
TTGTCGAGGTTTGCTATGCTTCAGGTCAAAAAGGAAAGCGAGAAAAAAGAAGAGGTTAAA
GATGATATTGATAAGGACTCGCCACATATGATTGACCTTTTTAAGTATACATGTAGCGAA
GTTACTGATAGGCTTGTGAGTTGTGCTGATTGGAATGGACCTAATCCTGATTTACTAGCA
GTTTCATATGGAGAATACAACTTCCTTGCAGAAAAAGCTCAATCAGGGAAACCATATCTT
GATAAACCTGGTTTACTACTTTTTTGGACCCTTAAAAGCCCAAAATTTCCTGAAAGGATA
ATCCGTGCCCCATCCGGTATAGTATCTTGTCACTTTTCTAAAAAAAACCCTTGGCTTATT
GCAACAGGTTCCTGTGATGGTGTAGTATCAATATATGATCTAAGGAAAAAAGGTGACAAA
CCCGCAGCAGAGTCTAGTCAAATGATAGAAAAGCACATCGACACAGTCTGGGAAGTAAAA
TGGCATGATCAAGGTAGTGAAAATGGAGAAAACCTCATATCAATATCATCAGATGGAAGA
ATAGTTGAATGGAGTATCAAAAAAGGTCTTGAATGCCGAGACTTACTAAACCTGAAAAAA
CCAACAAATCCTAATCAAAAAGATGACAAAGAAGCTGCGGTATTCAGGAACTCAGTAGGT
TTTTCATTAGATTTCCCAAAAGATCAATACATGCTTTATTTAGCTTCAACAGAAGAAGGG
ACAATTCATAAATGTTCTCTTAGTTATAACGATGAATTAGATACTTATTGGGGTCATTCA
GGACCAGTATATAAAGTTCGTTGTAGTCCTTTTTGGTCAAATATTATGTTGACATGTTCT
GCTGATTGGACTGTTCAAGTATGGGATTGGCGTAGAGATGAGTCACCATTATTTGCATGT
AGATCTCAAGATCTTAATGATGCGGTAAATGATATTGAATGGTCACCACATTCATCAACA
ATTTTCAGTAATGTTTGTGATGATGGAAGAGTTGAACTTTGGGATTTGTCAGTAAGTAAT
ATTGGGCCGATTATTACTAAAAAACCTGAAAATAGAAGCTCACCAGGGACGATGGTACGT
TTTTGTCAAGAATTCCCAGTCTTGGTAACTGGAAATTCACAAGGAGTTGTTGATGTTTAT
AGACTGAAAAACTTAAACCAAGAACTTTTGACTAAAGATGAACATAAAAAACGCTTAGAA
AAAGCTGTTTATCCTATAGAAAGATCAGGATATCACAAAGGAGAAGATGAAGAAGAAGAA
ATGGAAGGCATCGTAGATTAG