Identifiers and Description

Gene Model Identifier

SteCoe_26182

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007564507.095474162284704e-23RNA recognition motif-containi
ng protein
Oxytricha TrifallaxContig7157.0.g231.1548224173015786e-17RNA recognition motif. (a.k.a.
RRM, RBD, or RNP domain)

WormBaseWBGene000086880.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26182(Protein)
MESKSLTELLASNTTSELFSGTPFQAQKPVVVEPPKIEDEKKEVKSGENERIVFVGNVPL
ECKKKNIKRLFAQYGEVEKVWRRSIPVERGKLPVIAAVALKKYKEGNDSCNFYVLFQNKA
DAQQSLELNGNEFKGKHLRVDLASKPQQNTERTVFVGNLPFVVTDEEVWEEFKEFGEIDY
VRIIRDQHSHQGKGIGYVCFKDKKASKHAIAKNNSMFQGRRLRVSKARDSSEQQQEKMAP
APQKHYLNSKFFDPSKYKKQADIVEDAQLPKTRHPSSLKGTKKLVRKEQIKLQEKRKQRQ
ISNTKKLKVKKQKRDKS


>SteCoe_26182(CDS)
ATGGAAAGCAAATCCCTGACCGAACTTTTAGCTTCGAATACAACAAGCGAACTTTTTTCA
GGGACCCCTTTTCAAGCTCAAAAGCCAGTTGTGGTTGAACCTCCGAAAATCGAAGATGAA
AAAAAGGAAGTAAAATCAGGCGAAAATGAGAGGATTGTGTTTGTTGGTAATGTACCTTTG
GAGTGTAAGAAAAAAAATATCAAAAGACTATTTGCCCAGTATGGTGAAGTAGAAAAAGTT
TGGAGAAGGAGTATCCCTGTAGAAAGAGGAAAGCTCCCTGTTATAGCAGCAGTAGCTTTG
AAAAAGTACAAAGAAGGAAATGATTCTTGTAATTTTTATGTGTTATTTCAAAACAAAGCT
GATGCCCAACAAAGCTTAGAACTTAATGGCAATGAGTTTAAAGGGAAGCATTTAAGAGTA
GACTTAGCAAGTAAACCTCAGCAAAATACTGAAAGGACTGTTTTTGTTGGGAATTTACCT
TTTGTTGTTACTGATGAAGAAGTATGGGAAGAGTTTAAAGAATTTGGTGAAATTGATTAT
GTACGGATTATACGAGATCAACATAGTCATCAAGGAAAAGGTATTGGTTATGTGTGTTTT
AAAGATAAAAAAGCATCAAAGCATGCAATTGCTAAGAATAATAGTATGTTTCAAGGAAGG
AGATTAAGAGTTAGTAAAGCTAGAGATTCATCAGAACAACAGCAAGAAAAAATGGCCCCA
GCCCCTCAAAAACACTATCTTAATTCTAAGTTTTTTGATCCAAGCAAATATAAAAAACAA
GCTGATATTGTTGAAGATGCACAATTACCTAAAACTAGACACCCAAGTTCGCTTAAAGGG
ACTAAGAAACTTGTTCGTAAAGAGCAGATTAAACTACAGGAAAAAAGAAAACAAAGGCAG
ATTTCAAACACAAAAAAACTCAAAGTGAAAAAACAGAAAAGAGATAAATCTTAG