Identifiers and Description

Gene Model Identifier

SteCoe_26223

Standard Name

None

Aliases

None

Description

Bromo domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000047822.8625185805493937e-20
Oxytricha TrifallaxContig20462.0.g582.1151310375910805e-19PHD-finger

Saccharomyces CerevisiaeYHR119W6.305116760146989e-16Histone methyltransferase, sub
unit of the COMPASS (Set1C) co
mplex; COMPASS methylates hist
one H3K4; Set1p-dependent H3K4
trimethylation recruits Nrd1p
, allowing efficient terminati
on of snoRNAs and cryptic unst
able transcripts (CUTs) by Nrd
1p-Nab3p-Sen1p pathway; modula
tes histone acetylation levels
in promoter proximal regions
to ensure efficient Nrd1p-depe
ndent termination; required in
transcriptional silencing nea
r telomeres and at silent mati
ng type loci; has a SET domain
Tetrahymena ThermophilaTTHERM_013091300.000000000000001713908431542013SET domain containing protein;
homolog to MLL proteins in ma
mmals, Trithorax in Drosophila
, and SET1 in yeasts.

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26223(Protein)
MSRKKNFDFPEIGNISTLEYYNLLLNGKRATRYSTKEAQGSSQQTVQKPPVQKQVKKKPK
KDNSSPYKKKKNDELVPPSPPEEIAKLKYLYGCVYGEDAIERKIWIEDDTGMWSGVIEKF
EEVQGEDMLPVKYYVGGKCIDLREVKAYLSGEFVEYQGKECEVLWNFPPPLSYPEVLLKT
PECKIINADIHELRQPRLSTELNTWIEKRRDLEVHDSNINSFYFRFLSMKNSRQKVLLLR
KHEVTGKYFVYKDKQFRWINSDKITFFCNKTEPSIPFNLLASFVQGQNLRKLYKNYFMHC
EYSFPKIAQEDKQFRKQTRCKICEYILDVLEYKQCEDCQSCYHTQCLDPVACKAGFRNLW
RCPDCPRCENCLGKSDKLLRCMDCNNYFHEKCVDSNVLPTPGKLWKCELCAQCMHCKIRP
TEASVKWNENITKCTSCDSKWKKGEYCSICLNFWFSKKGRQSRTEQRLSQNDDPEMIECD
KCKMWVHLLCETSMTPILWQQFTADKNMKYYCPKCNKEKQNGEMQQIINQLIELEKNGYF
IKKIDEAYYSKVIKNPMFFDTMIENAKEGMYFNNTQLLRDHFTLLCENAMHYLKANTDGY
KAAKKLLDDGTNLLDMKFMPSKRKKPTSVPIQKKPKYESDLEDFNIELPTSLDTPEFYEF
SIDLLSSLPPVNFHPALTIIINKLDIQPFMGPKPLLSFYPDPISISFSDPVLCLIEQCYI
CASFIQTFGALVCRICSRAFHEFCIISPPIQNTNSWRCRDCRVCEICNSTQDAMNILYCK
KCEKGYDVQCLWPNVKGGLFLKDWVCDKCFKCERCSSKSYHKEGFNPSREDFFSDFSLCF
KCKWVVVNKDYCPECEKDWSSPYDQDPVVKDKILCRSCEYYFHPECAHDWKNVCSRCNEN
SFEYLRIEHGTVEKVQTLINLMSQSNVYQILSKQLIQNRYNLDPDLANLLANFFLVDNYE
FMTTNNEIRNFFNSRGVEIVRKTTKRKPQYENTRVGRIEGLRASEIPMPRSPLVRMHRPK
EFLHLWNIEWDTSAIILSLNKVLTPLDNIEVVEVLFQPKVSERPILCVISEFIWDFEDIS
EYMDFHKGPENTPTQRYDLLGSMTKESFFQSDEMMFDDRSDSGKYNDVSQEVLMKEYSHE
QTINYYISHEFPASLAFIRKFESWLKEHLLDITQHIINTSKILPSEEIKTQLPQSSLDKV
NENIQNDMTKCLSCILCKESGEKLISGRLIPCEDSTWVHVNCAFWSSEVRTDEHGVLLNF
HNSLSRGKKNKCKECGKVGATINCGAKKCHNSYHFPCALTGKVTLLENKNALCEGCSSSK
DSSKIACIDFLISTHQEKYTISKSKKQSKKPNFVQGQYNRIGSVILSDISNEKFLSYRLA
WVNGTRKVLRCEKKNGIFSVGICCNALDMSFLGSYIESNDMIKSSMENPQEMCSANEIED
LWPVLKKGESFVLKSAGDFFGINWSTYYSPVINNPELMSTVKDNKTILEKIANIKPSIFG
ASRLAPYTKHKAALKISKSHISQKSASHEEQLEGKSETSLVSEYRKYTKAIDRDSNLDVR
SSNIHGLGLFTLKDVSPGKIVVEYIGEIIRNRVADMREKEYEHKGIGQGSCYLFRLDEEH
VIDATVKGGKARFINHSCQPNCAASVCDIEGSKHILLFAKRFIHKGEEITYDYNFDVEED
KISCQCGSKDCQGKLN


>SteCoe_26223(CDS)
ATGTCTCGAAAGAAGAATTTTGATTTCCCTGAGATCGGAAACATCAGCACTTTAGAATAT
TATAACCTGTTGCTTAATGGGAAAAGGGCAACTCGATATTCTACTAAAGAAGCGCAAGGA
TCTTCACAGCAAACAGTACAAAAACCCCCAGTTCAGAAACAGGTAAAAAAAAAACCTAAG
AAAGACAATAGCTCACCTTATAAGAAGAAAAAAAACGATGAACTTGTCCCCCCATCACCA
CCTGAAGAGATAGCCAAACTTAAGTATCTTTATGGGTGTGTTTATGGAGAAGATGCTATT
GAAAGAAAAATTTGGATTGAGGATGATACGGGCATGTGGTCAGGAGTTATTGAAAAGTTT
GAAGAGGTTCAAGGAGAAGATATGCTTCCGGTTAAATATTATGTTGGGGGCAAGTGTATT
GATTTAAGAGAGGTCAAAGCTTATCTTTCTGGGGAATTTGTCGAGTACCAAGGGAAAGAA
TGTGAGGTTCTTTGGAACTTCCCTCCACCTCTTAGTTACCCTGAAGTGTTATTAAAAACT
CCTGAATGCAAGATTATTAATGCTGATATCCACGAACTTCGTCAACCAAGATTATCGACT
GAGCTTAATACTTGGATAGAAAAAAGGCGGGATCTTGAAGTCCATGACTCCAACATAAAC
AGTTTTTATTTTAGGTTCCTTAGTATGAAGAATTCAAGACAAAAAGTCCTTCTTTTAAGA
AAACATGAAGTTACAGGCAAGTATTTTGTATATAAAGACAAACAGTTTAGGTGGATTAAT
TCAGACAAAATCACATTTTTTTGCAACAAAACAGAACCGTCAATACCTTTTAATTTATTA
GCATCATTTGTTCAAGGACAGAATTTAAGGAAATTGTATAAGAACTATTTTATGCATTGC
GAGTACTCTTTTCCTAAAATCGCCCAGGAAGATAAACAGTTTAGGAAACAGACTAGGTGT
AAGATTTGTGAGTATATTTTAGATGTTTTAGAGTATAAACAGTGTGAGGATTGTCAGAGT
TGTTATCATACACAGTGTTTAGACCCTGTAGCATGCAAGGCTGGGTTTAGGAATTTATGG
AGATGTCCAGATTGCCCTAGATGTGAAAACTGCCTAGGGAAATCAGACAAACTCTTACGT
TGTATGGACTGTAACAACTATTTTCATGAAAAATGTGTTGACTCAAACGTCCTACCAACC
CCAGGGAAACTATGGAAATGTGAGCTTTGTGCCCAATGCATGCACTGCAAAATCCGCCCA
ACTGAAGCTAGTGTCAAATGGAATGAAAACATAACAAAATGCACATCATGTGATAGTAAA
TGGAAAAAAGGTGAATATTGCTCAATATGCCTAAACTTCTGGTTTTCAAAAAAAGGTAGA
CAAAGCCGTACTGAACAAAGACTAAGCCAAAACGATGATCCTGAAATGATCGAATGCGAC
AAATGTAAAATGTGGGTACATTTATTATGTGAAACAAGCATGACTCCTATCCTTTGGCAA
CAGTTCACAGCAGATAAAAACATGAAATATTATTGTCCTAAATGTAACAAAGAAAAACAA
AACGGGGAAATGCAACAAATAATCAACCAACTGATTGAGTTAGAAAAAAACGGGTATTTT
ATTAAAAAAATCGATGAGGCTTATTATAGTAAAGTGATAAAAAATCCAATGTTTTTTGAC
ACGATGATTGAAAATGCAAAAGAAGGAATGTATTTCAACAACACCCAATTATTAAGAGAC
CATTTTACCCTTTTATGTGAAAACGCAATGCATTATCTTAAAGCTAACACTGATGGATAT
AAAGCTGCTAAGAAACTTTTAGATGATGGTACGAATTTATTAGATATGAAATTCATGCCA
TCAAAAAGAAAAAAACCAACTTCGGTACCAATACAAAAAAAACCCAAATATGAATCTGAT
CTTGAAGATTTCAATATAGAACTCCCTACAAGTTTAGATACTCCAGAGTTTTATGAGTTT
TCTATAGATTTACTTAGTAGTTTACCACCTGTAAATTTTCACCCAGCTTTAACGATTATT
ATAAACAAGTTAGATATCCAACCTTTTATGGGCCCAAAACCTTTATTATCTTTTTACCCT
GACCCTATTTCTATATCATTTTCAGATCCTGTTCTTTGTTTAATAGAACAATGTTATATA
TGCGCATCATTTATTCAAACTTTTGGAGCACTTGTTTGTAGGATTTGTAGTAGAGCATTT
CATGAATTTTGTATTATAAGCCCACCAATACAAAATACTAATAGTTGGAGATGTAGAGAT
TGTCGGGTATGTGAGATTTGTAATAGCACCCAAGATGCAATGAATATTTTATATTGTAAA
AAATGTGAAAAAGGTTATGATGTTCAATGTTTATGGCCTAATGTTAAAGGTGGACTGTTT
CTTAAAGACTGGGTTTGCGATAAATGTTTTAAATGCGAAAGGTGTTCAAGTAAAAGCTAT
CATAAAGAAGGTTTTAATCCAAGTCGAGAGGATTTTTTCAGTGATTTTTCTTTGTGTTTT
AAATGCAAATGGGTTGTTGTGAATAAAGATTACTGCCCTGAATGTGAAAAGGATTGGAGT
TCACCATATGATCAAGACCCTGTAGTTAAAGATAAAATCTTATGTCGAAGTTGTGAATAT
TACTTCCATCCAGAATGCGCTCATGATTGGAAAAATGTTTGTAGTCGTTGTAATGAGAAC
TCATTTGAATATTTAAGAATTGAACATGGTACAGTAGAAAAAGTTCAAACACTTATAAAC
CTTATGAGTCAAAGTAATGTTTATCAAATTTTATCAAAGCAACTTATACAAAATAGATAC
AATCTCGACCCGGATCTAGCAAATTTATTAGCGAATTTCTTTCTTGTTGATAATTATGAG
TTTATGACAACAAATAATGAAATTAGGAATTTCTTTAATTCAAGAGGTGTTGAAATTGTA
AGAAAGACTACAAAAAGAAAACCACAGTATGAAAATACTAGAGTTGGGAGGATTGAAGGA
CTTAGAGCTTCGGAAATACCTATGCCTAGATCACCACTTGTTCGAATGCATAGACCGAAA
GAGTTTTTGCATTTGTGGAATATTGAATGGGATACTTCAGCTATAATTTTGAGTTTGAAT
AAAGTTTTAACACCTTTGGATAATATTGAGGTTGTTGAGGTACTTTTTCAGCCAAAAGTT
AGTGAAAGACCTATTTTGTGTGTGATTTCTGAATTTATTTGGGATTTTGAGGATATTAGT
GAGTATATGGATTTTCATAAGGGACCTGAAAATACCCCCACACAGAGATATGACCTTTTG
GGGAGTATGACGAAGGAATCGTTTTTTCAGTCGGATGAGATGATGTTTGATGATAGGAGT
GATAGTGGGAAGTATAATGATGTTTCGCAAGAAGTCCTAATGAAGGAGTATTCACATGAA
CAGACTATAAATTATTACATCAGCCACGAGTTCCCAGCTTCCCTGGCCTTCATTCGCAAA
TTTGAGTCCTGGCTTAAAGAGCATCTACTGGACATAACCCAGCACATAATAAACACATCA
AAAATCTTACCAAGTGAAGAAATCAAAACTCAATTGCCTCAAAGTTCCCTCGACAAAGTA
AACGAAAACATACAAAACGACATGACCAAATGCTTATCCTGTATTCTCTGCAAAGAATCT
GGAGAAAAACTAATAAGTGGAAGATTAATACCTTGTGAAGATAGTACCTGGGTTCATGTA
AACTGTGCATTTTGGAGTTCAGAAGTACGTACCGACGAACATGGTGTCTTACTAAATTTC
CACAACAGTTTATCTCGAGGTAAAAAAAACAAATGCAAAGAATGTGGTAAAGTAGGGGCA
ACAATAAATTGTGGGGCAAAAAAATGTCATAATTCCTATCATTTTCCTTGTGCCCTAACA
GGAAAAGTGACTTTACTAGAAAACAAAAATGCTTTATGTGAAGGGTGTTCCTCATCAAAA
GATTCATCAAAAATCGCATGTATAGATTTCCTTATATCAACTCATCAAGAAAAATACACA
ATATCCAAATCTAAAAAACAGTCAAAAAAGCCGAATTTTGTCCAGGGTCAGTATAATCGT
ATTGGTTCAGTAATTTTATCCGATATATCCAATGAGAAATTCCTTAGTTATAGACTTGCT
TGGGTTAATGGGACAAGAAAAGTCCTTAGATGTGAGAAAAAAAATGGGATATTTAGTGTT
GGTATCTGTTGTAATGCTTTAGATATGTCATTTTTAGGAAGTTATATTGAATCTAATGAT
ATGATAAAAAGTAGTATGGAAAACCCTCAAGAAATGTGTTCTGCTAATGAAATTGAAGAC
CTTTGGCCTGTTTTGAAAAAAGGTGAAAGTTTTGTTTTGAAGTCTGCTGGGGATTTTTTT
GGTATAAATTGGTCTACATATTATTCACCTGTTATTAACAATCCTGAACTTATGAGTACT
GTTAAAGATAATAAAACGATATTAGAAAAAATTGCTAATATAAAACCTTCGATATTTGGG
GCTAGTAGACTTGCACCTTATACTAAACATAAAGCTGCATTAAAAATTAGTAAAAGCCAT
ATAAGTCAGAAATCAGCTAGTCATGAAGAACAATTAGAAGGTAAAAGTGAGACTAGTTTA
GTTTCGGAATATAGGAAATATACTAAAGCTATTGATAGGGATTCCAATTTAGATGTTAGA
TCTTCGAATATTCATGGACTTGGACTTTTCACTTTGAAAGACGTTTCACCTGGGAAAATT
GTTGTGGAGTATATTGGGGAGATTATTAGGAATAGAGTTGCGGATATGAGAGAGAAGGAA
TATGAGCATAAAGGGATTGGACAAGGAAGCTGTTATCTTTTCCGTCTTGATGAAGAACAT
GTTATTGATGCTACAGTTAAAGGCGGCAAAGCTCGTTTTATCAACCATTCCTGTCAGCCG
AACTGCGCTGCATCAGTTTGTGATATTGAAGGCAGTAAGCATATCCTACTTTTCGCCAAA
CGTTTTATTCACAAAGGAGAAGAAATAACATATGATTACAACTTTGATGTAGAAGAAGAT
AAAATCTCATGCCAATGTGGATCTAAAGACTGCCAAGGCAAACTTAATTAG