Identifiers and Description

Gene Model Identifier

SteCoe_2628

Standard Name

None

Aliases

None

Description

Inhibitor_I29 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig322.1.g1166.054601895401186e-39Papain family cysteine proteas
e

Tetrahymena ThermophilaTTHERM_001611308.985825944049381e-37Papain family cysteine proteas
e containing protein
WormBaseWBGene000007763.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2628(Protein)
MLGSYNENRTSGWKKSTIAIIGVVAMACIIGTVAIVRSNDNKFMSILNAEEHEFHEFMAI
YNKVYATEEEFTHRFRIFRDNLAYIRVFNSMGDTMVLGVNEFADMDFIEFRSKYLTHRFP
ERQSENGETFEGLTAPTSVDWRTKGAVTPVKNQGQCGSCWAFSTTGSVEGAWFLAGHTLV
SLSEQQLVDCSRAQGNMGCNGGLMDDGFKYIIANKGITTEANYPYTAKDGICNKTKAAQV
AATISTYTDVTANNPTALQNAVAQQPVSIAVEADQNAWQLYKSGVVTKNCGTNLDHGVLI
VGYDTTASPPYWIVKNSWGASWGMEGYIEIEISSGPGVCGINKQPSYPVV


>SteCoe_2628(CDS)
ATGTTGGGTAGCTATAACGAAAACCGCACCAGCGGATGGAAAAAGTCAACCATTGCCATA
ATCGGCGTTGTAGCCATGGCCTGTATCATTGGAACAGTAGCTATAGTAAGAAGTAACGAC
AATAAATTCATGTCAATCCTTAATGCTGAGGAACATGAGTTCCATGAATTCATGGCTATT
TACAACAAAGTTTATGCCACAGAAGAAGAATTCACTCACAGATTCAGAATATTCCGTGAT
AATCTCGCTTACATTAGAGTTTTCAATTCAATGGGCGATACAATGGTTTTGGGTGTCAAT
GAATTTGCCGATATGGACTTTATTGAATTCAGAAGCAAATACTTAACCCATAGATTCCCA
GAGAGACAATCAGAAAATGGTGAAACTTTTGAAGGTTTAACTGCCCCAACTTCAGTTGAT
TGGAGAACTAAAGGTGCTGTTACCCCAGTGAAAAATCAAGGTCAATGTGGATCATGCTGG
GCTTTCTCTACCACCGGTTCAGTCGAAGGTGCATGGTTTCTTGCCGGCCATACTTTAGTA
TCCCTTTCAGAACAACAACTTGTTGATTGTTCAAGAGCTCAAGGTAATATGGGATGTAAT
GGAGGACTTATGGATGATGGTTTCAAATATATCATTGCTAATAAGGGTATTACAACTGAA
GCTAATTACCCATACACTGCTAAAGATGGAATTTGTAACAAGACTAAAGCTGCACAAGTT
GCCGCTACAATTTCAACTTATACTGATGTTACTGCTAATAACCCAACTGCTCTTCAGAAT
GCTGTAGCTCAACAACCAGTATCAATTGCTGTTGAAGCTGATCAAAATGCTTGGCAACTT
TATAAGTCTGGAGTTGTTACTAAGAACTGTGGAACCAATCTTGATCATGGTGTGCTTATT
GTTGGTTATGATACAACTGCTTCACCTCCTTATTGGATTGTTAAGAACTCTTGGGGTGCT
TCATGGGGTATGGAAGGATATATTGAAATCGAAATCTCAAGCGGACCTGGTGTTTGTGGC
ATTAACAAGCAACCATCTTACCCAGTCGTTTAA