Identifiers and Description

Gene Model Identifier

SteCoe_2629

Standard Name

None

Aliases

None

Description

DNAPK

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21910.0.g380NUC194 domain

Tetrahymena ThermophilaTTHERM_002030101.6889118802245324e-48Phosphatidylinositol 3- and 4-
kinase family protein. Sequenc
e similarity to the DNAPK subf
amily of the protein kinase PI
KK family (Eisen et al., 2006)
." homolog to human DNAPK_cs
Saccharomyces CerevisiaeYKL203C1.5628821893349888e-18PIK-related protein kinase and
rapamycin target; subunit of
TORC1, a complex that regulate
s growth in response to nutrie
nts and TORC2, a complex that
regulates cell-cycle dependent
polarization of the actin cyt
oskeleton; involved in meiosis
; TOR2 has a paralog, TOR1, th
at arose from the whole genome
duplication
WormBaseWBGene000025838.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2629(Protein)
MERRVEELLNTLHSLTFTDPESIIDEIRAIVLSPNLSMPSMAFFSSKLLNSEVSLLQFIL
KNRTDSDRLIWKTMSNALSLVSDYIRERGNRINEYVIEIKEVCLQLMASSTKSSLVKEAA
LRPLIKLIEVFSPNKLKLIIDPTELFIVLLESKLKYEERTMGSTLKGAIFNMLGMLVSSF
ENELQDKIEELQILMIIKLREELHKGPKTEEKTLAGLLKGMASGLKVFRYDKNQLKDIFI
YVKALLTPLKVGNYVVSKASLKVLSENAEMFKEFIREYSVEVIRTLFDINKLSNHKVKIL
VQETTERCLSVLSDSLQENYDKYTFDYIIKMLNMQINSKSQEVLQSTIRYLGVFSSAISK
IQGEAYLKGILETIMELGTNAISSEDEHTDFKSMFTLQKKLSSLLLAYSDIARNMNSIPE
SALLHFSDVAFEIFKRNIKIHKRYRQRMYNSIAQLFASLHLHHEKFIPWFRVFIAKSMKQ
LLEIPEEFIDSSNRIELASKLWTGIFQQECLNEIILDDMAQEIGSFFYHQISTLELSYSI
NSGELKAENSEDQQLLFQASEFAQLFLPKIGKRLTMWVMPYINILSKKITELPFLPSLYI
FIKVSFQIYEVSNYSESDLQSKSTLGNLLKFIFKKMQSFQDALLSSCIEVCLAAPICIVY
SDNINMLSLFEPIILQALTLGLSHLPLAHSVISVLNAWRASIPIKAFEEILPKILPALSP
YLTLNKITQEVQGQVEDQLARQKKKNIAYRIVKFLGSLGGACHYLVSAQNTELHLAWDSQ
PRLQMKIRFNLKYLEIDFDKILPRVIHLAEKSSDKKTKIISCELLHALILYMLGKKTQVD
FNFAKIYNNVFPVVYKLATDVELIIRQMFEPLSKQLVRWFARSFSYENPETMALLDALVD
GVCNQSNNMQRVLASECIGEFCRDVIMYNSNSIANFKSAFRRVQALSNHPQSEKRRGAIM
CLKKILAPLSLNEVLIDRFLLEFAHVVFVTTRLSHYDKSSEETLDYCKTTLNDLKALLEN
KFSVFCVSNDKRTYHKDLFSLLEWLWEQCKRPERVARKFAQDYWKTLSIISKYNLNAWKS
PENCQKDLEDVKKSTTNIQGAIDFVLWSSECGVREWNGEELEKKISEFLENDKKDEDIIE
ALRTLKVLIKYVEFYPHPQVNQDFLLKFLLTPNKIGFFPGAESQEFIVLYDKLSAKVINF
LINQGVKAENILKIWETAYFPTERLQKTGLKGLTALLESQTLLKTPVLQKVTEEFAKNME
NSLISKDSHEARKGKNQLEFFLKTKIEEKQLRTVLANSKLFQSNSEILYEYMSRNMESGF
GVFINSMAGKPEKMFEFLVPFLEKAKRLIEAKEVNLTIFLKNFIKQTTPLFATLALVPSP
EFSMGIIRAYCIFMEMAKDLSIFNEGLHELQNNEFFNHLVTLLEKFMARDQAFNVKKESF
HLYAISWEFYGIEIYKKLKPLFFEIQNQYFLPSTQNLQPSKETNDFEIMSRSFFELFNRI
PTLNNLELLHTLIREDKSLYEKELNQITMVLIKKVVAEGYETTFQTLIEMFYDPNTDKGI
IDNLRWGIAKRILIPMIDYADELMIEKLMIYCTQQMIGKITEIKFTEIYDSKEYLFRLRE
KTWILLIFERFFAKLPSNRLKENVHKALYGPGSQGNELTKQIIVFCSKYRKERPEKYELI
DSISASSDYIRQFCCAAYSCLLTCIRKTQSQEKVYVNYLFRDQNWKILLEEKEDFGFKPQ
TLFVKTEKKLEIVDEPKKLSYVYLSSSLFSQQATTIRAQKKIIVENNDEDEEKSNVFLEA
DELNTLTIMKPLIEVIERMENLFADSQEMPQWMQCLHSDLSNNSNFLAIRLFIIKIILNR
PQSFKKWADLWLGPICTVMSGNNGGTGLHYFLRDVCTLFLYDWDNISIKNKEKEAGKFLN
YLVKVGGDLNKEIFESNIKLITELIAKWKVPLEHRLIDGMLKKQLKDDDNKISYIWKLFG
IIIYGSAIDNKIKILSDGRENYESLDDSLLKSLEVPRRQIILSASEILGKRLEYSENLQT
SLFALLSRKESKEIGVYVNILEKVSICYPQILNNKNICFKLSGFINPLSGSTRASLLLLI
LHYAEYIKTCSTFANLPDLAEYLNRDREKIVNDNEDSHRIALLKLLLSLMDLLANPSIKK
MVSGIIPNLSSFASASSKDIRKLLYEVMQKAYDESKDMDESIKIRSKAREVLLKGLSDRE
FSDGIMKFWDHQDHLSLEAQMRMLQCLSEIYTPECEELWLVASSHLLVRLTELSTDYNKV
LFDNPLADCIYQDAQMNSDDFRSFPMTPMFSPSYYHQESIKKASQKSSQFAMPQRTSRIR
HLVEGSQASIEDRREKIKKAQQERLEQRINEQKNRQVNVTRSYRIGELPDIEIRTSDILK
PLANLILLDCEIASSIWVTICTALFTQFDDDAKRKTIQGLNRILEISENYNSDVISCIHK
TARELVSKNAKFSKEINAKFVAISGIRSMCYQSAIILLQECLLRYDNKEPFKAQSGIEKP
EVTRKNSEFWVALTKVYEKMGDSDSANGLWKVIFKSKSPENNDTIRKALDFKYEGEIIKA
TDEYLKIIDNSDADIKQEIMRDYLECKGYLGQWEDVKNCLPEMNGLKMKSFMRLNQFSQL
TEEVCKLPSNSLSLRFPYEMSLLNLTQDDTDRARHYLDLEFTHFVEKWQSLNPLSLIAKH
KLVQKLQKIFELSEFVTNIKPKKDEEEQEHKQNLISILNSYKTRTPSIALDDINTWEEIL
FARLLFYDTINQNINLNVEELNDYASSLYIGTAECALKHGWLDVSEKLLKDAINKRKDKT
KTSVSLLSSVIRLKAKTVIRNSEEYGFDLAIQHFQRLYESIKQYKSNNEDKDAINVLFGQ
IYSNETKMLLSYKTEAADVLPNCAKQAFYYLNQVRHTISALKFCRFCDMILRSYEEENGE
NKYVIGKCLNAMDVTGDMLAEIIVSSTLQSMKLGNQRAHDMFPRLIGLFKYQNVAKIFEN
ELEDFPEWMMIRWIDQVLAIFDKPECNVFAKIMERLVIKYPQIVYYPYKTFCSIDSLSGF
TKVKKGFKSLTWKILEEKFQDFGFLDNFIEALDILTYPEHRLKSFLDLIKDSIMQNSSSE
YINYLFNEMHKSIIGIKNPGVYNKKFAVDWEPTLSGFFGRGFTNINRMSTTELLQAIETI
AKKLANPSLPFGREKLSTFSEWLADYGLDILTPNSIEVPGIFTEDQEPFKRNSVSITSFD
QSILVLSSAKKPKRIGIHGSNEKDYLLLVKGGEDLRLDKRIQKVFMVMNRIFSNDPSCAK
LELKLKTFTIIPVTKKVGLLQWVSNTETLNTFITNELSKIYNISSLIEANKQRYSWLSSL
PAITTNNLPALHLEALKKDSNTIISNFREHESFIPWDLIRQGLLSLSTTPESFMHLRKQF
IHSLAAISICGYIIGLGDRHLDNFLLDKNDGGLLSIDFGVSFGHGVGLNLPELMPFRMTR
QFLSLMSPEGPQGELRQSMIICLKALRKHKNIILDCCEVFRNEPLLEWIKPLKTSYNVSE
EFADIPSFKLEVVKKKLTGINSALIMLEELEKTIHNNSNIQDRIAEAVLGPKDSLRNNNS
NVLSVDLQVDILLEHATDPNILGRTWIGWSPTV


>SteCoe_2629(CDS)
ATGGAAAGGCGCGTAGAAGAATTACTAAACACTTTGCACTCATTAACATTTACCGACCCA
GAGTCCATAATCGATGAAATCCGGGCAATAGTTCTAAGCCCTAACCTTTCTATGCCCTCC
ATGGCTTTTTTTTCATCAAAACTGCTCAATTCTGAGGTGTCTCTTCTTCAGTTCATTCTA
AAAAACCGAACCGATTCAGATAGACTCATATGGAAAACTATGAGTAATGCCCTTTCTCTA
GTCTCTGACTACATACGCGAAAGAGGAAATCGTATAAATGAATATGTTATAGAAATCAAA
GAAGTCTGCCTTCAATTAATGGCTTCAAGTACTAAATCTAGCCTTGTAAAAGAAGCAGCA
TTAAGACCTTTAATTAAACTCATTGAAGTTTTTTCACCTAATAAACTCAAATTAATCATC
GACCCAACTGAACTTTTTATTGTGTTATTAGAAAGCAAATTGAAATATGAGGAAAGAACT
ATGGGGTCAACTTTAAAAGGGGCGATTTTTAATATGCTTGGCATGCTTGTGAGTAGTTTT
GAAAATGAATTACAGGATAAGATTGAAGAATTACAGATACTAATGATTATAAAATTACGT
GAAGAATTACATAAAGGGCCGAAAACTGAAGAAAAAACCTTAGCTGGTTTACTTAAAGGT
ATGGCATCAGGGCTTAAGGTATTTCGATATGATAAAAACCAATTAAAAGATATTTTTATA
TATGTCAAAGCACTTTTAACACCTTTAAAAGTTGGGAATTACGTTGTTTCGAAAGCGAGT
TTGAAAGTGTTATCTGAGAATGCTGAGATGTTTAAAGAGTTTATTAGAGAATATAGTGTT
GAGGTTATAAGGACACTTTTTGATATAAATAAATTGTCTAATCACAAGGTGAAAATACTT
GTACAAGAAACTACAGAAAGATGCTTATCGGTACTTTCGGATAGTTTACAGGAAAATTAT
GATAAATATACTTTTGATTATATTATCAAAATGCTTAATATGCAAATTAATTCTAAGTCA
CAAGAGGTTTTACAGAGTACTATAAGGTATTTAGGGGTTTTTAGTTCGGCAATATCTAAG
ATTCAAGGGGAAGCATATTTAAAAGGGATTTTAGAAACTATTATGGAGTTAGGGACGAAT
GCGATTAGTAGTGAGGATGAACATACTGATTTTAAAAGCATGTTTACATTACAGAAAAAA
CTCTCTTCGCTTTTATTAGCGTATTCTGATATTGCTAGGAATATGAATTCAATCCCAGAA
TCTGCTCTTCTACACTTTTCTGATGTAGCATTTGAAATATTCAAACGAAATATAAAAATT
CATAAAAGATACCGACAGAGAATGTATAACTCAATAGCTCAGCTTTTTGCATCTTTGCAC
TTACATCATGAAAAATTTATCCCATGGTTTAGAGTTTTTATAGCAAAATCAATGAAACAG
TTATTAGAAATCCCTGAAGAGTTCATAGATTCAAGCAATAGAATTGAATTAGCAAGTAAA
CTATGGACTGGAATATTTCAGCAAGAGTGTCTTAACGAAATTATCCTTGATGATATGGCT
CAAGAAATAGGTTCTTTTTTCTATCATCAGATATCAACCCTAGAATTATCATATTCAATA
AATTCAGGCGAATTAAAAGCTGAAAACTCCGAAGACCAGCAGCTTCTTTTCCAAGCAAGT
GAATTCGCCCAGCTTTTCCTACCAAAAATCGGTAAACGTCTGACAATGTGGGTTATGCCG
TACATCAACATCCTAAGCAAAAAAATCACAGAACTTCCATTTCTCCCATCTTTATACATT
TTCATCAAAGTATCATTTCAAATCTATGAAGTTTCCAACTATAGCGAAAGTGACCTTCAA
AGCAAGTCAACATTAGGAAATCTTTTAAAATTTATCTTCAAAAAAATGCAAAGTTTCCAA
GATGCTCTTCTAAGCAGTTGTATCGAAGTATGCTTAGCAGCACCAATATGTATAGTCTAT
AGTGATAATATTAACATGTTATCTTTATTTGAACCTATAATATTACAAGCTTTGACATTA
GGTTTAAGCCATTTACCATTAGCCCATAGTGTAATTTCAGTTCTAAATGCATGGAGAGCA
TCAATTCCTATAAAAGCTTTCGAAGAAATTCTACCAAAAATTCTCCCAGCTTTATCCCCA
TATTTGACTTTAAATAAAATCACACAAGAAGTTCAAGGTCAAGTCGAAGATCAACTTGCC
AGACAAAAGAAAAAAAATATTGCTTATAGAATTGTTAAATTCCTTGGATCACTTGGAGGT
GCATGTCATTATCTAGTAAGCGCACAAAACACGGAATTGCATTTAGCTTGGGATTCACAA
CCAAGACTTCAAATGAAAATCAGATTTAATTTGAAGTATTTAGAAATTGACTTTGATAAA
ATCTTACCAAGGGTTATTCATTTAGCTGAAAAAAGCAGTGATAAAAAAACTAAAATCATA
TCTTGTGAACTTTTACATGCTTTAATATTATATATGCTTGGGAAAAAAACACAAGTTGAC
TTTAATTTTGCCAAGATTTATAATAATGTGTTCCCTGTTGTTTATAAATTAGCTACTGAT
GTTGAATTAATTATAAGACAGATGTTTGAACCTTTATCAAAACAATTGGTTAGATGGTTT
GCTAGGTCTTTTAGTTATGAGAATCCAGAGACTATGGCTTTATTAGATGCATTGGTTGAT
GGTGTATGTAATCAATCGAATAATATGCAAAGGGTTTTAGCTTCAGAATGTATTGGGGAA
TTTTGTAGAGATGTAATTATGTATAATTCGAATTCGATTGCTAATTTCAAGTCAGCTTTT
AGAAGGGTGCAAGCTTTGTCAAACCATCCACAGAGTGAAAAACGTAGAGGGGCGATTATG
TGCTTGAAGAAAATTTTGGCCCCGTTAAGTTTGAATGAAGTACTGATTGATAGGTTTTTA
CTTGAATTTGCCCATGTTGTATTTGTGACAACTCGGCTTTCTCATTATGATAAATCATCG
GAAGAAACGCTAGATTACTGCAAAACCACTCTTAACGATCTCAAAGCATTACTTGAAAAC
AAATTCTCAGTCTTCTGCGTAAGTAACGACAAAAGAACTTATCACAAAGATCTCTTCAGT
TTACTTGAATGGTTATGGGAACAATGTAAACGTCCAGAAAGAGTAGCTAGAAAGTTCGCC
CAAGACTACTGGAAAACTTTATCAATAATATCAAAATACAATCTAAATGCTTGGAAAAGT
CCAGAAAACTGTCAAAAAGACTTGGAAGATGTTAAAAAAAGTACTACAAACATTCAAGGG
GCTATTGATTTTGTTTTATGGAGTAGTGAATGTGGTGTAAGAGAATGGAACGGAGAAGAA
CTTGAAAAGAAAATATCAGAGTTTCTAGAAAATGATAAAAAAGATGAAGATATCATTGAA
GCTTTACGAACATTAAAAGTCTTAATAAAATACGTAGAATTTTACCCTCATCCACAAGTA
AACCAAGATTTCCTATTGAAATTCCTCTTAACTCCTAATAAAATAGGGTTTTTCCCTGGG
GCAGAAAGCCAAGAATTTATTGTGTTATACGATAAACTAAGTGCAAAAGTTATAAATTTC
CTAATAAACCAAGGGGTTAAAGCTGAAAATATACTAAAAATATGGGAAACCGCATATTTC
CCAACAGAACGTTTACAAAAAACAGGTCTTAAAGGGTTGACAGCTTTGCTTGAAAGCCAG
ACCCTTTTAAAAACCCCAGTTTTACAAAAAGTTACAGAGGAATTTGCTAAAAACATGGAA
AATTCTCTAATATCCAAAGATTCTCACGAGGCCAGAAAAGGGAAAAACCAATTAGAATTT
TTTTTGAAAACCAAAATTGAAGAAAAACAGCTGAGAACAGTTTTAGCTAATTCTAAGCTT
TTTCAATCAAATAGCGAAATACTCTATGAGTATATGTCAAGAAACATGGAATCAGGATTT
GGGGTTTTTATAAACAGTATGGCTGGAAAACCTGAAAAAATGTTTGAGTTTCTAGTACCA
TTTTTAGAAAAAGCTAAAAGGCTTATTGAAGCTAAAGAAGTTAATTTGACGATATTTTTG
AAGAATTTTATTAAACAGACTACACCTTTATTTGCTACTTTGGCACTCGTACCATCACCA
GAGTTTAGTATGGGAATTATACGTGCGTATTGTATTTTTATGGAAATGGCTAAAGATTTA
TCTATTTTTAATGAGGGTTTACATGAACTTCAGAATAATGAGTTTTTTAACCACCTTGTT
ACTTTACTTGAAAAGTTTATGGCAAGAGATCAAGCATTCAATGTAAAAAAAGAATCTTTT
CATTTGTATGCGATATCCTGGGAGTTCTATGGTATTGAAATCTATAAAAAACTAAAACCA
TTGTTTTTCGAAATCCAAAACCAGTATTTTCTCCCATCAACCCAAAACCTTCAGCCATCT
AAAGAAACAAATGATTTTGAGATCATGTCCCGATCATTTTTTGAACTTTTTAATCGTATT
CCTACACTTAATAATCTTGAACTTCTTCATACACTTATTAGAGAAGATAAAAGTCTTTAT
GAAAAAGAACTCAATCAAATCACAATGGTTTTAATTAAAAAAGTCGTAGCCGAAGGCTAC
GAAACAACTTTTCAAACGTTAATAGAAATGTTTTATGATCCAAATACAGATAAAGGGATA
ATTGATAATTTACGTTGGGGGATTGCAAAAAGAATTCTAATCCCAATGATTGATTATGCA
GATGAGCTTATGATAGAAAAACTTATGATATATTGTACCCAACAAATGATAGGGAAAATA
ACAGAGATAAAATTCACAGAAATCTATGATTCGAAAGAGTATCTTTTTAGACTTAGGGAA
AAAACTTGGATTTTGCTTATTTTCGAAAGGTTTTTTGCTAAACTTCCATCAAATAGACTT
AAAGAAAATGTTCATAAAGCTCTTTATGGGCCTGGGTCTCAAGGAAATGAATTAACTAAA
CAGATAATTGTTTTTTGTAGTAAATATAGAAAAGAAAGACCTGAAAAATATGAATTAATT
GATTCTATAAGCGCTAGTTCAGATTATATAAGACAATTTTGTTGTGCTGCATATTCATGT
TTATTAACATGTATTAGGAAAACTCAAAGCCAAGAAAAAGTTTATGTGAATTATCTTTTT
AGAGATCAAAACTGGAAGATTTTGTTAGAAGAAAAAGAGGATTTTGGATTTAAACCACAG
ACTTTGTTTGTAAAAACAGAAAAGAAACTAGAAATTGTTGATGAACCTAAGAAATTATCT
TATGTTTATTTATCATCTTCATTGTTTTCACAACAAGCAACTACAATTAGAGCTCAGAAG
AAAATTATAGTTGAAAATAATGATGAAGACGAAGAAAAAAGTAATGTTTTCTTGGAAGCT
GATGAGTTGAACACCTTGACAATTATGAAACCTTTGATTGAAGTTATTGAAAGGATGGAG
AACTTATTTGCTGATTCACAGGAAATGCCACAATGGATGCAATGCCTTCATAGCGACCTA
AGCAACAATTCCAACTTTTTAGCAATACGGCTTTTTATAATCAAAATTATATTAAACCGT
CCTCAAAGCTTTAAAAAATGGGCTGATCTCTGGTTAGGCCCAATTTGCACAGTCATGAGT
GGTAACAACGGTGGAACAGGTCTCCATTATTTTCTCCGAGATGTTTGCACTTTATTTCTT
TATGACTGGGACAACATCTCAATAAAAAATAAAGAAAAAGAAGCAGGTAAATTCTTAAAC
TATCTAGTCAAAGTTGGTGGTGATCTTAACAAAGAAATATTTGAATCTAACATAAAACTC
ATAACTGAACTTATCGCAAAATGGAAAGTCCCACTTGAACATAGACTTATTGATGGTATG
TTAAAAAAACAACTAAAAGATGATGATAATAAAATCTCATACATATGGAAACTTTTTGGT
ATAATAATCTATGGCTCAGCTATTGACAACAAAATAAAAATCCTAAGCGATGGTCGGGAA
AACTATGAATCATTAGACGATAGTCTTCTTAAAAGCTTAGAAGTCCCTCGTCGACAAATC
ATCTTATCTGCAAGTGAGATTTTAGGTAAAAGGCTTGAATATAGCGAAAATTTGCAAACA
TCTTTATTTGCCCTTCTTAGTAGAAAAGAATCAAAAGAAATTGGAGTTTATGTCAACATT
CTTGAAAAAGTGTCAATTTGTTATCCACAAATCCTCAACAATAAAAACATTTGCTTTAAA
CTTAGTGGGTTTATAAACCCTCTTAGTGGTAGTACAAGGGCAAGTCTTTTATTATTAATC
CTTCATTATGCAGAATATATCAAAACATGCTCTACATTTGCTAATCTCCCAGATTTAGCA
GAATATCTTAATAGAGATCGTGAGAAAATTGTAAATGATAATGAAGACTCACATAGAATT
GCATTATTAAAACTATTATTATCATTAATGGATTTACTGGCAAATCCAAGTATAAAAAAA
ATGGTATCAGGGATTATTCCAAATCTTAGTTCCTTTGCCTCAGCATCAAGTAAAGATATC
AGAAAACTTTTATATGAAGTGATGCAAAAAGCATATGATGAATCTAAAGATATGGATGAG
TCTATTAAAATTCGTTCAAAAGCTAGAGAGGTTTTATTAAAAGGTTTATCAGATAGAGAG
TTTAGTGATGGGATAATGAAATTTTGGGACCATCAAGACCATTTATCTTTAGAGGCTCAA
ATGAGAATGCTTCAATGTTTAAGTGAAATTTATACACCTGAATGTGAAGAACTTTGGCTT
GTAGCATCAAGTCATTTACTTGTAAGATTGACTGAATTAAGTACTGATTATAATAAAGTG
TTATTTGATAACCCATTAGCAGATTGTATATATCAAGATGCTCAAATGAATTCTGATGAT
TTTAGAAGTTTTCCTATGACTCCAATGTTTTCACCATCTTATTATCATCAAGAGTCGATT
AAAAAGGCTTCACAGAAATCTTCGCAGTTCGCTATGCCGCAGAGGACTTCAAGAATAAGA
CATTTAGTAGAAGGGTCGCAAGCTAGTATTGAAGATAGAAGGGAAAAGATTAAAAAAGCA
CAACAAGAACGCTTAGAACAAAGAATAAATGAGCAGAAAAATAGACAAGTTAATGTTACG
AGATCATATCGGATTGGAGAACTGCCTGATATAGAAATCCGCACAAGTGATATTTTAAAA
CCTTTAGCGAATCTAATTCTCTTAGACTGTGAAATCGCAAGTTCTATATGGGTGACTATC
TGCACAGCTCTTTTTACACAATTCGATGATGATGCTAAACGTAAAACAATACAAGGACTT
AATAGAATACTTGAAATCAGTGAGAATTACAATTCTGATGTTATAAGTTGTATACATAAA
ACAGCCCGTGAACTTGTATCGAAAAATGCTAAGTTTTCTAAAGAAATCAATGCGAAATTC
GTCGCTATTAGTGGAATAAGGTCGATGTGTTATCAAAGCGCTATAATACTTTTACAAGAA
TGTTTATTAAGATATGATAACAAAGAACCTTTTAAAGCTCAAAGTGGGATTGAAAAGCCT
GAAGTTACAAGGAAGAATAGTGAGTTTTGGGTTGCCCTAACTAAAGTATATGAGAAAATG
GGCGATAGTGATAGTGCGAATGGGCTTTGGAAAGTGATTTTTAAAAGTAAGTCTCCAGAG
AATAACGATACGATAAGAAAAGCTTTAGATTTTAAGTATGAAGGAGAGATCATTAAAGCT
ACTGATGAGTATTTGAAGATTATTGATAATAGTGATGCGGATATTAAACAAGAAATTATG
AGAGATTATTTAGAATGTAAAGGTTATTTGGGACAATGGGAGGATGTAAAGAATTGTTTG
CCTGAAATGAATGGGTTGAAAATGAAGTCATTTATGAGATTGAATCAGTTTTCTCAGTTG
ACTGAAGAAGTATGTAAATTGCCTTCAAATAGTTTGAGTTTAAGATTCCCTTATGAAATG
AGTCTTTTGAATCTAACTCAAGATGATACTGATCGTGCAAGACATTATTTAGACTTAGAA
TTCACCCATTTTGTAGAAAAATGGCAATCGTTAAATCCTTTGTCTTTAATCGCAAAGCAT
AAACTAGTCCAAAAACTACAAAAAATCTTTGAACTGTCTGAATTCGTCACAAACATCAAG
CCTAAAAAAGATGAAGAAGAACAAGAGCATAAACAAAACCTAATTTCTATATTAAATTCA
TATAAAACTAGAACACCATCAATTGCCCTAGATGATATCAATACTTGGGAAGAAATTCTT
TTTGCTAGACTATTGTTTTATGATACAATCAACCAAAATATAAACTTAAATGTAGAGGAA
CTTAATGATTATGCCTCATCTTTATATATAGGAACAGCTGAATGTGCATTAAAACATGGT
TGGCTTGATGTTTCAGAAAAGTTACTTAAAGATGCTATTAATAAAAGAAAAGATAAAACA
AAAACAAGTGTTTCATTACTTTCTTCAGTTATAAGATTAAAAGCAAAAACAGTTATTAGG
AATTCAGAAGAATATGGGTTTGATTTAGCAATTCAACATTTTCAAAGATTATATGAAAGT
ATAAAACAATATAAATCAAATAATGAAGATAAAGATGCTATAAATGTATTATTTGGGCAA
ATCTATTCTAATGAAACTAAAATGCTCCTTTCTTATAAAACTGAAGCTGCTGATGTTTTA
CCGAACTGTGCAAAACAAGCGTTTTATTATTTGAATCAAGTCAGACATACGATTTCTGCG
TTAAAATTCTGCAGGTTTTGCGATATGATTTTAAGGTCTTATGAAGAAGAAAACGGGGAA
AATAAATATGTTATAGGTAAATGTTTAAATGCTATGGATGTTACTGGGGATATGCTTGCT
GAAATTATTGTATCTTCCACATTACAATCTATGAAACTTGGAAATCAAAGGGCTCATGAT
ATGTTCCCAAGATTAATTGGATTATTTAAATATCAAAATGTTGCTAAGATATTTGAAAAT
GAACTTGAAGATTTTCCGGAATGGATGATGATAAGGTGGATTGATCAAGTATTAGCAATA
TTTGATAAACCAGAATGTAATGTTTTTGCTAAAATCATGGAGAGATTAGTTATAAAATAC
CCACAGATAGTATATTACCCTTATAAAACTTTCTGTTCAATAGACTCATTATCAGGTTTT
ACAAAAGTGAAAAAAGGGTTTAAATCCTTAACGTGGAAGATTTTGGAAGAAAAGTTCCAA
GATTTTGGGTTTTTAGATAACTTTATCGAGGCTTTAGATATTTTAACATACCCAGAGCAT
AGATTGAAAAGTTTTTTAGATTTAATCAAAGATAGTATTATGCAGAATTCATCATCAGAA
TATATAAACTACCTTTTCAATGAAATGCATAAAAGCATTATTGGGATAAAAAACCCAGGG
GTTTATAATAAAAAGTTTGCCGTTGACTGGGAACCAACTTTATCAGGGTTTTTTGGCAGG
GGTTTTACGAATATAAACAGAATGTCGACAACAGAATTATTACAAGCAATTGAAACTATA
GCGAAAAAACTAGCAAATCCATCTTTGCCATTTGGTAGAGAAAAACTCAGTACTTTTTCA
GAATGGCTTGCCGACTATGGTCTTGATATTCTTACACCTAACAGTATAGAAGTCCCAGGG
ATTTTCACTGAAGATCAAGAACCTTTTAAAAGAAATTCAGTTAGTATCACATCTTTTGAT
CAATCAATACTAGTCTTAAGCTCAGCAAAAAAACCTAAACGTATTGGGATTCATGGTTCT
AATGAAAAAGATTATTTATTATTAGTAAAAGGAGGAGAAGATTTGAGGTTAGATAAAAGA
ATACAAAAAGTGTTTATGGTAATGAATAGAATATTCTCTAATGACCCTAGTTGTGCTAAA
TTAGAACTGAAACTTAAAACTTTTACAATAATCCCTGTGACAAAAAAAGTTGGGCTTTTG
CAATGGGTTAGTAATACAGAGACTTTGAATACTTTTATAACAAATGAATTATCGAAAATT
TATAATATATCCAGTTTGATTGAAGCTAATAAACAAAGATATTCTTGGCTTAGTTCTTTA
CCCGCTATAACAACAAATAATTTACCTGCATTACATTTAGAAGCTTTGAAAAAAGATTCA
AATACGATAATATCGAATTTTAGGGAACATGAAAGTTTTATACCTTGGGATTTGATAAGA
CAAGGGTTGTTAAGTTTGAGTACAACTCCTGAGAGTTTTATGCATTTACGTAAACAATTT
ATTCATTCTTTAGCTGCTATAAGTATTTGTGGATATATTATTGGTCTTGGGGATAGGCAT
TTGGATAATTTCTTACTTGATAAAAATGATGGAGGTTTGTTGTCTATTGATTTTGGGGTA
TCTTTTGGCCATGGTGTTGGTTTAAATTTACCTGAACTTATGCCTTTTAGAATGACAAGA
CAGTTTCTAAGCCTTATGTCCCCAGAAGGACCTCAAGGTGAATTAAGACAATCAATGATT
ATTTGTCTTAAAGCACTTAGAAAACATAAGAATATTATTTTAGACTGTTGTGAAGTATTT
AGAAATGAACCTTTGCTTGAATGGATAAAACCTTTAAAAACTTCTTATAATGTATCAGAA
GAATTTGCTGATATTCCTTCTTTTAAGTTGGAAGTTGTCAAGAAAAAACTTACTGGGATT
AATTCGGCTTTGATTATGCTTGAGGAACTTGAAAAAACAATTCATAATAATTCTAATATT
CAAGATAGAATTGCTGAAGCTGTGCTTGGACCTAAAGACTCTTTGAGGAATAATAATTCA
AATGTGCTTTCTGTGGATTTGCAAGTAGATATTCTTTTAGAGCATGCTACAGATCCTAAT
ATATTAGGAAGGACTTGGATAGGATGGTCTCCTACAGTCTAA