Identifiers and Description

Gene Model Identifier

SteCoe_26406

Standard Name

None

Aliases

None

Description

Ribosomal_L6e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12123.0.g111.9287498479639178e-22Ribosomal protein L6e

Saccharomyces CerevisiaeYML073C2.8625185805493937e-20Ribosomal 60S subunit protein
L6A; N-terminally acetylated;
binds 5.8S rRNA; homologous to
mammalian ribosomal protein L
6, no bacterial homolog; RPL6A
has a paralog, RPL6B, that ar
ose from the whole genome dupl
ication
Tetrahymena ThermophilaTTHERM_001361207.781132241133797e-20Ribosomal protein L6e family
WormBaseWBGene000044176.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26406(Protein)
MVKWYPTEDVQKVRVKRANKPSKLRGRISPGQVLILLAGKHQGKRVIFLKQLEGGLLLVT
GPYKFNGVPLKRVPQAYTVPTSTKVDVSGSDFSKINDAYFAKEKENAKKTEEAFFAPKKE
KKPFSDAKKAMQKSVDAGIAGKITDPIVKKYLKTKFRLRNGMFPHTLKF


>SteCoe_26406(CDS)
ATGGTGAAGTGGTACCCTACAGAGGATGTCCAAAAAGTCAGAGTAAAAAGAGCTAATAAG
CCTTCAAAACTTAGAGGAAGGATTTCACCAGGACAAGTATTGATTTTACTAGCAGGAAAG
CATCAAGGTAAAAGAGTCATCTTTTTAAAACAACTTGAAGGTGGCCTTCTTCTAGTAACA
GGTCCATACAAATTCAATGGAGTCCCTCTTAAAAGAGTCCCACAAGCTTACACAGTCCCT
ACTTCGACTAAAGTTGATGTATCAGGAAGTGATTTCTCTAAGATCAATGATGCATATTTC
GCTAAAGAAAAGGAAAATGCTAAAAAGACTGAAGAAGCATTTTTTGCACCTAAAAAAGAA
AAAAAACCTTTTTCAGATGCGAAGAAAGCTATGCAGAAAAGCGTGGATGCTGGGATTGCA
GGGAAAATTACTGACCCAATTGTTAAGAAGTATTTGAAAACGAAGTTTAGACTTCGAAAT
GGAATGTTCCCTCATACTCTTAAGTTTTAG