Identifiers and Description

Gene Model Identifier

SteCoe_26787

Standard Name

None

Aliases

None

Description

DYRK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6472.0.g373.5722699376192174e-67Protein kinase domain

Tetrahymena ThermophilaTTHERM_003534202.6395702969591894e-66Protein kinase domain containi
ng protein. Sequence similarit
y to the DYRK2 protein kinase
subfamily (Eisen et al., 2006)
."
WormBaseWBGene000031501.2806276389220833e-57
Saccharomyces CerevisiaeYJL141C4.906094730649281e-35Serine-threonine protein kinas
e; component of a glucose-sens
ing system that inhibits growt
h in response to glucose avail
ability; upon nutrient depriva
tion Yak1p phosphorylates Pop2
p to regulate mRNA deadenylati
on, the co-repressor Crf1p to
inhibit transcription of ribos
omal genes, and the stress-res
ponsive transcription factors
Hsf1p and Msn2p; nuclear local
ization negatively regulated b
y the Ras/PKA signaling pathwa
y in the presence of glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26787(Protein)
MYKPQSYLTNELSPQRKLAIKSKKPTIKINFSLNKSSQHKHNLSELSTPKYSNPNKFVKV
PATTTAKKVKEIPKLLFTKIRYDGDVNLSTTRARKHKHTLSENINLLDYSSASNTKVTGI
KQLNSNNKQTENISSTDSLVKVSTPRRIIEEERKLLWHSTKLPATPATVLKIFMHKMNNF
EQAEILSYHEIYFIGNYFTNSGKDVITRNNGYDDDRGDYKITIGDHIAYRFEILNILGRG
SFGQVVRVFDHKNKLEVALKIIRNKSRFHEQALVEIEILKYLKDKDANDNYCIVHLEDYF
IFRKHMCITFELLSINLYEFLKSNSFQGLSSSLIRRFASQILHALLLLNRYKIIHCDLKP
ENILLKQPNRSALKVIDFGSSCFYEKRMYTYIQSRFYRAPEIILGISYSTSIDIWSFGCI
LVELYTGYPLFPGESESEQIQCMMEVLGLPPISVMDRSTRKKLFFDQDGTPKITANSRGK
IRLPGRKSLRDLLKGSDIAFLDLVCGCLEWDPIKRITPEEALAHDWMIDNAKKLNKSNSR
GGSAQPHQGLTSRHNKKTSEITVKPTLHRSHKKSLNLFN


>SteCoe_26787(CDS)
ATGTACAAGCCTCAGTCTTACTTAACAAATGAATTATCTCCTCAAAGAAAACTAGCGATT
AAGTCCAAAAAGCCTACAATAAAAATAAATTTCAGCCTGAACAAATCCTCACAACATAAA
CACAATTTATCAGAACTATCAACACCAAAATATTCAAACCCAAATAAATTTGTTAAAGTT
CCAGCAACAACAACTGCAAAAAAGGTAAAAGAAATTCCTAAATTACTATTCACTAAAATT
CGATATGATGGTGATGTTAACTTATCAACAACAAGAGCAAGAAAACATAAGCATACTTTA
AGTGAAAATATTAATCTTCTTGATTATTCAAGTGCCTCTAATACAAAAGTTACAGGAATT
AAACAGTTAAACTCAAATAATAAACAAACAGAAAATATTTCATCAACAGACTCATTAGTT
AAAGTTTCAACCCCGCGCAGAATTATTGAAGAAGAAAGAAAACTTCTTTGGCATTCTACA
AAACTCCCAGCAACTCCAGCTACAGTATTAAAAATCTTCATGCATAAAATGAACAACTTT
GAGCAAGCTGAGATTTTAAGTTATCATGAAATATATTTTATAGGTAACTATTTTACAAAT
AGTGGAAAAGATGTTATAACTAGAAATAACGGATACGATGATGATAGAGGAGATTATAAA
ATAACAATTGGTGACCATATTGCTTATAGATTTGAAATCTTAAATATTTTAGGTAGAGGA
AGCTTTGGTCAAGTAGTTCGGGTGTTTGATCATAAAAATAAACTTGAAGTAGCATTGAAA
ATTATAAGAAATAAATCAAGATTTCATGAACAAGCTTTAGTTGAGATTGAAATATTAAAA
TACCTTAAAGACAAAGATGCTAATGATAATTATTGTATTGTTCATCTTGAAGATTATTTT
ATTTTTAGAAAACATATGTGTATAACATTTGAGCTTTTGAGTATCAACCTTTATGAATTT
CTTAAAAGTAATAGTTTTCAAGGTTTGTCTTCAAGTTTGATAAGACGTTTTGCGTCACAG
ATTCTTCATGCTTTGCTTTTATTGAATCGTTATAAAATAATCCACTGTGATTTAAAACCT
GAGAATATATTATTAAAACAACCTAATAGGTCAGCATTGAAAGTTATAGATTTTGGGTCT
TCATGTTTTTATGAAAAGCGTATGTATACTTATATTCAAAGTCGTTTTTATAGAGCTCCA
GAGATTATATTAGGAATATCATATAGTACTAGTATTGATATATGGAGTTTTGGGTGTATT
TTAGTAGAATTGTATACAGGGTATCCTTTATTTCCTGGAGAAAGCGAAAGTGAACAAATT
CAGTGTATGATGGAAGTGTTAGGACTGCCTCCAATTTCAGTAATGGACAGGTCTACAAGA
AAAAAACTGTTTTTTGACCAAGATGGGACCCCTAAAATAACTGCAAATTCTAGAGGCAAA
ATAAGACTTCCTGGGAGAAAAAGTTTAAGAGATTTACTTAAAGGGTCTGATATCGCATTT
CTCGACCTTGTATGTGGATGTTTAGAATGGGACCCTATAAAAAGAATCACTCCAGAAGAA
GCTTTGGCTCATGATTGGATGATTGATAATGCGAAAAAACTTAACAAAAGTAATTCTAGA
GGAGGCAGTGCACAACCTCATCAAGGTCTAACCTCAAGACATAATAAAAAAACAAGTGAA
ATAACAGTCAAACCTACTCTTCATAGATCACATAAAAAGTCTTTAAACCTCTTTAACTAA