Identifiers and Description

Gene Model Identifier

SteCoe_268

Standard Name

None

Aliases

None

Description

SF3A3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006492802.820770088460135e-53splicesome-associated protein,
putative
Oxytricha TrifallaxContig19116.0.1.g1027.667648073722e-53hypothetical protein

WormBaseWBGene000117581.8048513878454153e-35
Saccharomyces CerevisiaeYDL030W3.1391327920480296e-17Subunit of the SF3a splicing f
actor complex; required for sp
liceosome assembly; acts after
the formation of the U1 snRNP
-pre-mRNA complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_268(Protein)
MSSEIEQLRSNQEEIEYLEKAIVKAMFFKSQNPRNVILADYIIKIFLDEIQSRSVQALKI
YQDEDHLKREEISFLEGNRTGPSSTGNRSLDVWLNYYEKINSLKDYHEKYTPYGTPAEIF
DDNWFFLHSLDDKSRIPKFSGQEGYGRYVDLHTNYMEFMNLKKIQNNKRCNFKYLDYVAF
LATFDQFHEIPIFCKDRNYEVYMENLLIYLKSFFERTQPLFNLQQMEEICNRAFEEAWKN
RNIKGWEFIPKILRVDPLYCVPCKKLFTNRNVYKAHKKGMKHRKNAERIAEILEEEEDFS
EVERLKNIARKESFVTRLRENLGDIIEDSMNNIRKKQTRTAEELELYESDQEEPFKMPIE
ELKKKSETKKKEESSDSEQERPAYNPLNLPIGFDGKPIPYWLYKLHGLNVEYKCEICGNY
SYWGRRAFERHFQEWRHAHGMRCLRIPNTMHFREITRIEEAVQLHKKLMQDHQLDMFRPE
DEEECEDSLGNVMTRKKFNDLKRQGIL


>SteCoe_268(CDS)
ATGTCGTCTGAGATTGAGCAACTCCGTTCAAACCAAGAAGAAATCGAGTATCTCGAAAAA
GCGATAGTAAAAGCAATGTTTTTCAAATCCCAAAACCCAAGAAACGTGATTTTAGCTGAC
TACATAATCAAAATTTTCCTCGACGAAATCCAGTCTAGAAGCGTCCAAGCCTTAAAAATT
TACCAAGACGAAGACCATCTAAAACGTGAAGAAATTTCCTTTCTCGAAGGTAATCGTACA
GGTCCAAGTTCAACAGGTAACCGTTCTCTAGATGTTTGGTTGAATTATTACGAAAAAATC
AATTCACTCAAAGACTATCATGAAAAATACACTCCATATGGAACCCCTGCAGAAATCTTC
GATGACAATTGGTTTTTCCTCCATAGTCTAGACGACAAATCTCGTATTCCAAAATTCTCA
GGTCAAGAAGGTTATGGTCGATATGTTGATCTTCATACAAACTATATGGAATTCATGAAC
TTAAAAAAAATCCAAAACAACAAAAGGTGCAATTTCAAATACTTAGACTATGTAGCTTTT
TTAGCTACTTTTGATCAATTTCATGAAATTCCAATATTTTGTAAAGATAGGAATTATGAG
GTTTATATGGAAAATTTATTGATTTACCTTAAAAGTTTTTTTGAAAGGACCCAACCATTA
TTTAATCTTCAACAAATGGAAGAAATATGCAATAGAGCTTTTGAGGAAGCTTGGAAAAAT
AGGAATATTAAAGGATGGGAGTTTATACCTAAAATTTTAAGGGTTGATCCTTTGTATTGT
GTTCCTTGCAAAAAGCTTTTTACTAATCGAAATGTGTATAAAGCGCATAAAAAAGGGATG
AAACATAGGAAAAATGCTGAGAGAATTGCTGAGATATTAGAAGAAGAAGAAGATTTCAGT
GAGGTTGAAAGACTGAAAAATATTGCTAGGAAGGAAAGTTTTGTTACTAGACTTAGAGAG
AATTTAGGTGATATAATTGAGGATTCTATGAATAATATAAGGAAAAAACAAACAAGGACT
GCTGAAGAACTGGAATTGTATGAGAGTGATCAGGAGGAGCCTTTTAAGATGCCAATTGAA
GAACTTAAGAAAAAATCTGAGACGAAAAAAAAAGAAGAAAGTAGTGATTCTGAACAAGAA
CGTCCTGCTTATAATCCTTTGAATTTGCCTATTGGTTTTGATGGTAAACCTATACCTTAT
TGGCTTTATAAACTTCATGGACTTAATGTGGAATATAAATGCGAGATTTGTGGGAATTAT
TCTTATTGGGGAAGAAGGGCTTTTGAGAGGCATTTTCAAGAATGGCGTCATGCACATGGT
ATGAGATGTTTAAGAATTCCTAATACAATGCATTTTAGAGAGATTACAAGGATTGAAGAA
GCTGTTCAACTACATAAGAAACTCATGCAAGATCATCAGTTGGATATGTTTAGGCCTGAA
GATGAAGAAGAATGCGAGGATTCACTAGGAAATGTTATGACTAGGAAAAAATTCAACGAC
CTTAAAAGACAGGGAATTTTATAA