Identifiers and Description

Gene Model Identifier

SteCoe_26850

Standard Name

None

Aliases

None

Description

vATP-synt_AC39 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004334703.392270193026015e-47vacuolar ATP synthase
Oxytricha TrifallaxContig5208.0.g471.368539471173853e-44ATP synthase (C/AC39) subunit

WormBaseWBGene000162581.603810890548638e-28
Saccharomyces CerevisiaeYLR447C1.4251640827409352e-21Subunit d of the V0 integral m
embrane domain of V-ATPase; pa
rt of the electrogenic proton
pump found in the endomembrane
system; required for V1 domai
n assembly on the vacuolar mem
brane; the V0 integral membran
e domain of vacuolar H+-ATPase
(V-ATPase) has five subunits

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_26850(Protein)
MELLTFNIDDGFPEALIRGLRGSFIRKDEYDAIKDCSNLSDVRMVLEETDYLPFLQSEPT
PTPTAVIRNKMKEKLAREFEFIKSNATPELYNFLEKVSHRFMIDNVVNMIEVIKNKDVKR
LKIAPDPLGYFRGMEDILRFDGEDVAELYQIVLIDTPVGDYFNRLLEDLINAGAMQNRSI
DDVQRQFAEITPEILRISLRKMWLEDLHDLCKNLSSTSKEVLLDLVKFEADCMTIQIIYN
SLNNPDLNKQSERESGRRSLCPNIGYLYPDYEIQLNKVYDLQTLRQAVDSFPLYKDMLAR
VADPSNENEMKSPDMKTLDDIMYEKGIVKYSMAFDQQFHYGAFYAYLKLKEQEIRNVIWL
SEMVNIQKPKQEPAWRKYENLIPFYCLKSSA


>SteCoe_26850(CDS)
ATGGAGCTCTTAACCTTCAACATAGATGACGGCTTTCCTGAAGCTCTTATTCGTGGATTG
CGAGGGTCTTTTATCCGTAAAGATGAATACGATGCTATAAAAGACTGTAGTAATTTATCT
GATGTCAGAATGGTCTTAGAAGAAACTGATTATCTTCCTTTCCTTCAAAGTGAACCAACA
CCAACACCAACTGCAGTTATTCGTAACAAAATGAAAGAAAAACTTGCAAGAGAATTCGAG
TTCATAAAGTCTAATGCCACACCTGAACTTTATAACTTTTTAGAAAAAGTTTCACATAGA
TTTATGATTGATAATGTAGTCAATATGATTGAAGTTATTAAAAACAAAGATGTAAAAAGA
CTTAAAATTGCCCCAGACCCACTTGGATATTTTAGAGGTATGGAAGATATTTTAAGATTT
GATGGAGAAGATGTCGCTGAATTGTATCAGATTGTGCTTATTGATACACCAGTTGGGGAT
TATTTTAATAGGTTACTTGAGGATTTGATTAATGCTGGAGCTATGCAGAATAGAAGTATT
GATGATGTGCAGAGACAGTTTGCGGAGATTACACCGGAAATATTGAGGATATCTTTGAGA
AAAATGTGGCTTGAAGACCTCCATGATCTATGTAAAAATTTGAGTTCGACTAGTAAGGAG
GTTCTTTTAGATTTAGTCAAATTTGAAGCTGATTGTATGACTATACAAATTATATACAAC
TCATTAAACAACCCAGACTTAAACAAACAATCAGAACGTGAAAGTGGCCGAAGATCTTTA
TGCCCTAATATTGGGTATCTTTATCCAGATTATGAAATCCAATTAAATAAAGTGTATGAT
TTACAGACATTAAGACAAGCTGTTGACTCTTTTCCATTATATAAAGATATGCTAGCCCGT
GTTGCAGACCCATCTAATGAAAATGAAATGAAAAGCCCAGATATGAAAACATTAGATGAT
ATCATGTATGAAAAAGGTATTGTTAAATACTCAATGGCTTTTGATCAACAGTTTCATTAT
GGAGCTTTTTATGCTTATCTAAAACTTAAAGAACAAGAAATTAGAAACGTGATTTGGCTT
TCAGAAATGGTTAATATTCAAAAACCTAAGCAAGAGCCTGCTTGGCGTAAGTACGAAAAC
CTCATACCTTTTTACTGTTTGAAAAGCTCAGCTTAA