Identifiers and Description

Gene Model Identifier

SteCoe_2706

Standard Name

None

Aliases

None

Description

Exo_endo_phos domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1164.1.g321.2995814250075031e-24Endonuclease/Exonuclease/phosp
hatase family

Tetrahymena ThermophilaTTHERM_004751107.095474162284704e-23Endonuclease/Exonuclease/phosp
hatase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2706(Protein)
METDIKILTLNLFLRPPGIHTNDSDYKDLRTYVFIDQCISSYDIICLQEVFSTLNSRKKQ
IINQAKNKGFLYHCQSPRPNPFYGHIIDSGLLILSKYPIVENDSITFSEGKSADRLSSKG
VVYAKIKVDDIFLHIFTTHTQASYNTPEYEEFLKYRLLRRRQIKEYKDFIDLKTLNTSYP
TIITGDFNIDGLENRKPPKFSSPCQDDYIHLTWIFSSEGTNDIIDIIRSKYGKSLATYGR
VYENGLPIETILTAKEYSTSNECLDYIFLIPNKVIYN


>SteCoe_2706(CDS)
ATGGAAACAGATATCAAAATACTCACACTAAATTTATTCCTTAGACCTCCAGGAATACAT
ACTAACGATTCTGATTACAAAGACCTAAGAACTTATGTTTTTATAGATCAATGCATTTCT
TCCTATGATATAATCTGTTTACAAGAAGTTTTTTCAACACTGAATTCTCGGAAAAAACAA
ATAATTAACCAAGCTAAAAACAAAGGTTTTTTATATCATTGCCAAAGTCCTCGACCAAAT
CCATTTTATGGGCATATAATAGACAGTGGATTGCTAATTCTTAGCAAATACCCAATAGTA
GAAAATGATAGTATAACCTTTTCTGAAGGAAAAAGCGCAGATAGATTGAGTTCAAAGGGA
GTTGTTTATGCTAAAATAAAAGTAGATGATATTTTTCTGCATATTTTTACTACTCATACA
CAAGCCTCCTATAACACTCCTGAATATGAAGAATTTTTAAAATACAGGCTTTTACGACGA
AGACAAATAAAAGAATACAAAGACTTCATAGACCTTAAAACTCTCAACACAAGCTATCCA
ACAATAATAACCGGGGACTTCAACATTGATGGTCTTGAAAATCGTAAACCCCCAAAATTT
TCATCTCCTTGTCAAGACGATTATATCCATTTAACATGGATTTTTTCCTCTGAAGGGACA
AACGATATAATAGATATAATCAGAAGCAAATATGGGAAATCCTTAGCGACATACGGTAGA
GTTTATGAAAATGGTTTGCCTATAGAAACAATCCTAACAGCAAAAGAATACTCAACTTCT
AATGAATGCTTAGACTACATTTTCCTAATCCCCAACAAAGTAATCTATAATTAG