Identifiers and Description

Gene Model Identifier

SteCoe_27119

Standard Name

None

Aliases

None

Description

Mito_carr domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18180.0.g432.7487850079102147e-43Mitochondrial carrier protein

Tetrahymena ThermophilaTTHERM_007216403.0144087850653746e-40Mitochondrial carrier protein
WormBaseWBGene000151862.9374821117108028e-30
Saccharomyces CerevisiaeYLR348C0.000000000000012664165549094176Mitochondrial dicarboxylate ca
rrier; integral membrane prote
in, catalyzes a dicarboxylate-
phosphate exchange across the
inner mitochondrial membrane,
transports cytoplasmic dicarbo
xylates into the mitochondrial
matrix

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27119(Protein)
MSGDKKPSVYKNFLIGGAAGMFATSCIQPIDFVKVQLQIKGEGQKGVKSSPITIARETIA
KYGVRRLYTGLDSALLRQATYTTARMGIYKTMMDWGNEKYNNRVPVWLKGAFSLAAGGLA
AIVGNPADLSLIRMQSDHTLPPEKRRNYTGVGNALTRIVREEGTLALWRGCTPTIARAMS
LNFGMLGPYDQAKEVLQKQFGNFTGIGPASSFIAAFFACVFSLPFDNVKTKFQKMIKGPD
GQYPYKSFGDCFTKSLKSEGPLGLYVGFFTYVTRIAPHVIITLLTTDFLNSRFNK


>SteCoe_27119(CDS)
ATGTCAGGAGATAAGAAGCCTTCTGTTTATAAGAACTTTCTCATTGGTGGGGCCGCAGGG
ATGTTTGCTACTTCTTGCATCCAGCCAATTGACTTCGTAAAGGTTCAGCTTCAAATTAAA
GGAGAAGGACAAAAAGGCGTGAAGTCAAGTCCAATTACTATTGCCCGTGAAACTATTGCT
AAATACGGAGTTAGACGCCTTTATACAGGTTTGGACTCAGCTTTACTCCGTCAGGCAACC
TATACAACTGCTCGTATGGGTATTTACAAGACTATGATGGATTGGGGTAATGAAAAATAC
AACAATCGAGTTCCAGTTTGGTTGAAAGGTGCTTTCTCGCTAGCTGCTGGTGGATTGGCT
GCAATTGTTGGTAATCCCGCTGATCTTTCCCTTATTAGAATGCAGAGTGACCATACTTTA
CCTCCTGAAAAGAGAAGAAATTATACTGGTGTAGGCAACGCTCTTACTAGAATTGTAAGA
GAAGAAGGAACTCTTGCTCTTTGGAGAGGATGTACTCCAACTATTGCAAGGGCTATGTCT
TTGAACTTTGGTATGCTCGGACCCTATGACCAGGCTAAAGAAGTTCTCCAGAAGCAATTC
GGTAACTTCACAGGTATTGGCCCAGCCAGCTCATTCATAGCTGCCTTCTTTGCATGTGTT
TTCTCTTTACCTTTCGACAATGTAAAGACTAAATTCCAGAAGATGATTAAAGGACCAGAT
GGGCAATACCCATATAAGAGTTTCGGTGACTGCTTCACAAAATCCTTGAAAAGTGAAGGC
CCTCTTGGCCTTTATGTGGGCTTCTTCACCTATGTGACAAGAATTGCCCCACACGTCATC
ATTACATTGTTGACAACAGACTTCTTGAACTCTCGGTTCAATAAATAG