Identifiers and Description

Gene Model Identifier

SteCoe_27181

Standard Name

None

Aliases

None

Description

tRNA_anti-codon domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14211.0.g473.665820411179563e-77tRNA synthetases class II (D,
K and N)

WormBaseWBGene000010942.194878508014299e-72
Saccharomyces CerevisiaeYLL018C5.814040485895939e-62Aspartyl-tRNA synthetase, prim
arily cytoplasmic; homodimeric
enzyme that catalyzes the spe
cific aspartylation of tRNA(As
p); class II aminoacyl tRNA sy
nthetase; binding to its own m
RNA may confer autoregulation;
shares five highly conserved
amino acids with human that wh
en mutated cause leukoencephal
opathy characterized by hypomy
elination with brain stem and
spinal cord involvement and le
g spasticity (HBSL)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27181(Protein)
MDAIGLYASFADKNQLKKIARPKLPKYMPSTEVKIMTEADPEDALKENYGDSPMVQSAYD
DTRVFIKVANLNVEIENPVWIRARVHSTRIKGQAGFIIIREGTQTLQCVISTSAEVSKQM
MKYTSGISKESIVDIFGQCKVPEQAIESSSITSFEFYIKKIHVISRSLATLPFQLEDANK
PMTLEEALNEGKETTQAKDQKNKKENERARVSQDIRLNNRYIDLRLPVNQAIVRLSAAVC
QLFREFLMGEGFIEIHTPKLIAGTSEGGCEVFRTSYFGRSACLAQSPQLYKQMAIMADLG
RVFEIGPVFRAENSNTHRHLCEFVGLDIEMTIQNSYFEVIDVINKMFFYIFEGLTTRYAS
ELDAVYKYFPFIVPFKWTKEPVTLTFAEACDLLHAEGIEQSVHEDFSTVIEKKLGEIVRR
KYETDFYVVHRYPESARPFYTMICKDDPRFTCSYDVFLRGEEIISGAQRIHDPDLLRKRA
IYKDIELSGIQSYIDSFKYGAFPHGGCGIGLERVVMLFSGIKNIKWTSMFPRDPKRLTP


>SteCoe_27181(CDS)
ATGGACGCGATCGGACTATACGCATCTTTCGCTGATAAGAACCAGTTGAAAAAGATAGCT
AGACCTAAGCTTCCAAAATATATGCCAAGCACTGAGGTAAAAATCATGACAGAAGCTGAT
CCTGAAGATGCTCTTAAAGAAAACTATGGCGATTCCCCAATGGTCCAATCAGCCTATGAC
GACACAAGAGTTTTTATAAAAGTCGCAAATTTAAACGTAGAAATTGAAAACCCAGTATGG
ATCAGAGCTCGTGTTCATAGTACTCGTATTAAAGGTCAAGCTGGATTTATCATTATTCGT
GAAGGGACTCAAACCTTACAATGTGTCATCAGCACCTCAGCCGAAGTATCAAAGCAAATG
ATGAAATACACATCAGGGATTTCTAAAGAAAGCATTGTCGATATCTTCGGGCAATGTAAA
GTTCCTGAACAGGCAATTGAAAGTTCATCAATCACAAGCTTTGAGTTTTACATAAAAAAA
ATCCACGTCATTTCCAGATCTCTAGCAACTTTACCATTCCAATTAGAAGATGCTAATAAA
CCTATGACTTTAGAAGAAGCTTTAAATGAAGGAAAAGAAACAACACAAGCAAAAGATCAA
AAAAATAAGAAAGAAAATGAAAGGGCTAGAGTAAGTCAAGATATAAGATTAAACAATAGA
TATATAGATTTAAGACTTCCAGTTAATCAAGCTATTGTACGTTTAAGTGCTGCAGTATGT
CAATTGTTTAGAGAATTCTTAATGGGTGAAGGGTTTATCGAGATCCATACACCAAAACTT
ATAGCCGGTACATCTGAAGGTGGTTGTGAAGTTTTTAGAACAAGTTATTTTGGTAGAAGT
GCTTGTTTAGCTCAAAGTCCTCAATTATACAAGCAAATGGCTATTATGGCTGATTTGGGT
CGAGTATTCGAAATTGGTCCTGTTTTCAGAGCTGAGAATTCTAACACTCATAGACATTTA
TGTGAATTTGTTGGCCTTGATATAGAAATGACAATACAAAACAGTTACTTTGAAGTTATT
GATGTGATCAATAAAATGTTTTTTTATATATTCGAAGGACTTACTACCAGATATGCTAGT
GAACTTGATGCTGTTTATAAATACTTCCCATTTATAGTCCCATTTAAATGGACTAAAGAA
CCTGTTACTTTAACTTTTGCTGAAGCTTGTGATTTACTTCATGCTGAAGGGATTGAACAA
AGTGTACATGAAGATTTCTCAACTGTTATTGAAAAGAAACTTGGGGAAATTGTTAGGAGA
AAATATGAGACTGATTTTTATGTTGTTCATAGATACCCAGAAAGTGCAAGACCTTTTTAT
ACTATGATATGTAAAGATGATCCTAGATTCACTTGTTCTTATGATGTTTTCCTTCGTGGT
GAAGAAATTATTTCTGGTGCACAAAGAATTCATGATCCTGATCTTTTACGTAAAAGAGCT
ATTTATAAAGATATTGAACTTTCTGGTATTCAAAGTTATATTGACAGCTTTAAATATGGA
GCTTTTCCTCATGGTGGTTGTGGTATTGGCCTTGAACGTGTTGTTATGTTGTTTTCTGGA
ATCAAGAATATTAAGTGGACGAGTATGTTCCCAAGAGATCCTAAAAGACTTACCCCATAA