Identifiers and Description

Gene Model Identifier

SteCoe_27185

Standard Name

None

Aliases

None

Description

PAP_central domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11888.0.g82.506567475899953e-46Poly(A) polymerase central dom
ain

WormBaseWBGene000117911.2160992992528256e-37
Saccharomyces CerevisiaeYKR002W1.8048513878454153e-35Poly(A) polymerase; one of thr
ee factors required for mRNA 3
'-end polyadenylation, forms m
ultiprotein complex with polya
denylation factor I (PF I), al
so required for mRNA nuclear e
xport; may also polyadenylate
rRNAs; required for gene loopi
ng
Tetrahymena ThermophilaTTHERM_0001513795.900090541597061e-29poly(A) polymerase central dom
ain protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27185(Protein)
MSIVDTIVVDASFPSNEDIALNTLLNSLLLALDNFESEEESRRRKVVLGKISELFRDWCY
QKILKKPGMNEEMAQSAGGKIFTFGSYRLGVHGPGTDIDILCVSPRYITREEFERDMFEV
LKKQPCVSKITAVFKTKVPLIKMIFDNVPIDLLYACLSGYDRIGEDMKDLMDDNVISRCD
EKTTLSLNGPRNTDTTLSLVPNLDNFRTTLRVIRLWAKRRGVYSNVLGFPGGAAWSIMVA
KVCKMYPNYLPSQLVRKFFKVYDMWDWNQNVFLKQVEQMAVNSAEPGLMMVMTPAFPSFN
STYTVNKHSKQAICDEFHLANKVTSMIEEGGSGWNDLFEPLDFFAQFRHFIRVEILATTA
SDFEDWSGFILSKLRILFYENLDMLKPPPYVRVYPEDVPLSDPKFPYAVAYYAGLKFFKQ
TTAETSRSVDLRIPVFRFIDSIYKMRRENGYNVNNTNLRVKFLAKDDLSEEISKMPNPSI
KRRFRSFDNTVDPEKKQKLEGEDKNLSSENLPVPIVMSLPVIPQSNGPQKKLTFNFKNKG
TN


>SteCoe_27185(CDS)
ATGTCAATAGTAGACACCATCGTAGTTGACGCTAGCTTTCCATCAAACGAAGACATAGCT
CTCAACACCTTGCTGAACTCTCTTCTCTTAGCCCTCGACAACTTCGAAAGCGAAGAAGAA
AGCCGGCGTAGGAAAGTCGTCCTAGGTAAAATCTCAGAGCTTTTTCGTGACTGGTGCTAT
CAAAAAATCCTCAAAAAGCCTGGGATGAACGAAGAAATGGCCCAGTCTGCAGGTGGGAAA
ATCTTTACATTCGGTTCATATCGTCTAGGAGTTCATGGTCCAGGTACCGATATTGATATT
CTCTGTGTTTCCCCTCGATACATAACCCGAGAAGAGTTTGAAAGGGATATGTTTGAAGTC
TTAAAAAAACAACCTTGTGTATCAAAAATCACAGCAGTCTTCAAAACAAAAGTCCCTCTA
ATCAAAATGATTTTTGATAATGTGCCAATTGATTTGCTTTATGCATGTTTAAGTGGTTAT
GATCGAATAGGTGAAGATATGAAAGATTTGATGGATGATAATGTTATAAGTCGATGTGAT
GAAAAAACTACATTAAGTCTTAATGGTCCAAGAAATACTGATACAACATTATCTTTGGTT
CCAAATCTTGATAATTTTAGAACAACGTTAAGGGTCATAAGGCTCTGGGCTAAGCGTAGA
GGGGTTTATTCAAATGTTCTTGGGTTTCCTGGAGGAGCAGCTTGGAGTATTATGGTAGCA
AAGGTCTGTAAAATGTATCCAAATTATTTACCCAGTCAATTGGTAAGAAAATTTTTTAAG
GTTTATGACATGTGGGACTGGAATCAAAATGTATTTTTAAAACAAGTTGAACAAATGGCT
GTTAATAGTGCTGAACCTGGGCTTATGATGGTTATGACCCCTGCTTTTCCTAGTTTTAAT
TCTACGTATACTGTGAATAAACATAGTAAACAAGCGATTTGTGATGAGTTCCATTTAGCG
AATAAAGTAACTAGTATGATTGAAGAAGGGGGTTCTGGGTGGAATGACCTTTTTGAGCCT
TTGGACTTCTTTGCCCAGTTTAGACACTTTATAAGAGTAGAAATTCTAGCTACAACTGCT
AGTGACTTTGAAGATTGGAGTGGGTTTATATTAAGCAAGCTCAGGATTTTGTTTTATGAA
AATCTCGATATGTTAAAACCCCCACCTTATGTTCGTGTATATCCTGAAGATGTTCCTTTA
TCAGACCCGAAATTCCCTTATGCTGTTGCTTATTATGCAGGTTTAAAGTTTTTCAAACAA
ACCACAGCAGAGACAAGCCGTAGTGTTGATTTACGTATCCCCGTCTTTCGGTTCATCGAC
TCTATTTACAAAATGCGTCGAGAGAATGGGTATAATGTCAATAACACTAACTTAAGGGTA
AAATTCCTAGCAAAAGATGACCTTTCAGAAGAAATTTCCAAAATGCCGAACCCAAGCATT
AAAAGACGATTCAGAAGTTTTGACAACACAGTTGACCCTGAAAAAAAACAAAAACTTGAA
GGTGAGGATAAAAACCTTAGTTCAGAAAACCTCCCTGTCCCTATTGTTATGAGTTTACCA
GTGATTCCTCAATCAAATGGACCTCAAAAAAAACTCACATTTAACTTCAAAAATAAAGGC
ACTAATTGA