Identifiers and Description

Gene Model Identifier

SteCoe_27373

Standard Name

None

Aliases

None

Description

dCMP_cyt_deam_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13657.0.g741.9792598779469045e-32Cytidine and deoxycytidylate d
eaminase zinc-binding region

Tetrahymena ThermophilaTTHERM_004981802.8625185805493937e-20Cytidine and deoxycytidylate d
eaminase zinc-binding region f
amily protein
Saccharomyces CerevisiaeYHR144C2.8625185805493937e-20Deoxycytidine monophosphate (d
CMP) deaminase; involved in dU
MP and dTMP biosynthesis; expr
ession is NOT cell cycle regul
ated

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27373(Protein)
MIIIGITGTLCSGKKTAAEYLQMCFGFKILDVESEKWDQIGNHSSKIYSEDDYLNEESYR
EANARIILRSTEENISVNYVIYPITLPEELNVFRTASNFMLIGIDAPTLKRFGHYNVKYI
RRKSPLANFLEIDDKINFGLNGYPAHVYECMYSSDKIVVNSGEKDRFFDDLRALEVLNPE
HYRPGWDTYFMRIAEMAATRTNCMKRGVGAVVVNNYRVISAGYNGTPAGILNCIDGGCPR
CSSQAEQGTMLEDCMCMHGELNAILFAGYENCAGTTLYTTLFPCLLCAKSIVQAGIVRVV
YEEEYNHSELSFSLLEQAGIKIDRHSSIVPSQF


>SteCoe_27373(CDS)
ATGATTATTATAGGCATAACTGGAACTCTTTGTTCTGGGAAAAAAACTGCGGCAGAATAT
TTACAGATGTGTTTTGGGTTTAAAATCCTTGATGTTGAAAGCGAGAAGTGGGATCAAATT
GGTAACCATTCAAGTAAGATTTATTCAGAGGATGACTATTTGAACGAAGAATCATATCGT
GAAGCTAATGCCCGCATTATATTAAGATCAACTGAAGAGAACATCTCTGTCAACTATGTT
ATTTATCCAATAACACTTCCTGAAGAGTTAAATGTATTCAGAACAGCAAGCAATTTTATG
TTAATTGGAATTGATGCCCCAACTTTAAAGCGCTTTGGTCACTACAATGTTAAGTATATT
AGAAGAAAAAGTCCTTTGGCGAATTTTTTGGAAATAGACGACAAAATAAATTTTGGTTTG
AATGGTTATCCAGCTCATGTTTATGAATGCATGTATTCTTCAGATAAAATTGTAGTGAAT
TCTGGTGAAAAAGATAGATTTTTTGATGATCTTAGAGCTTTGGAAGTTCTAAATCCTGAA
CATTATAGACCTGGTTGGGATACTTATTTTATGAGAATTGCTGAAATGGCAGCTACAAGA
ACAAACTGCATGAAAAGAGGTGTTGGTGCTGTTGTTGTTAATAATTATAGGGTTATATCT
GCAGGTTATAATGGTACTCCTGCAGGTATATTAAATTGTATTGATGGAGGATGTCCTAGA
TGCAGCTCACAGGCCGAACAAGGGACTATGCTAGAAGATTGTATGTGCATGCATGGTGAA
TTAAATGCAATTTTATTTGCGGGATATGAAAATTGTGCTGGGACAACTCTTTATACTACC
CTATTTCCTTGTTTACTCTGTGCAAAGTCGATTGTCCAAGCTGGGATTGTAAGGGTGGTT
TATGAAGAAGAGTATAATCATTCTGAGCTTAGCTTCTCATTGCTGGAGCAAGCTGGGATT
AAAATAGATCGGCATTCTTCGATAGTTCCTTCACAATTTTAG