Identifiers and Description

Gene Model Identifier

SteCoe_27681

Standard Name

None

Aliases

None

Description

E2F_TDP domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transcription factor activity, sequence-specific DNA binding (IEA) | GO:0003700

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000164100.00000001522997974471263hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27681(Protein)
MEKNIPHHISKIINELHEENNKEEVLIRYSFLLCKDVSLMQIYLELGFCLKSNSFTRSVN
TAQVLSLFSQEYGIQQHNIDNYLANAPVSADNDSEMRQELLRFFYDQGINEIASSVDLGL
EIPEDNTLAAMWQDYTPQSKSQQFSTPKPKKFHKTPSTQATRYLTPSPLNTPYSEESEME
TPRSTRGLKHLTTLVKHLVCKHQPTSFKNVAVKLIDELIVTDGPDRLKEEKNVRRRVYDA
INVLIAAEVLERNGRNVSWKEKWDSVEIDMRKTETEKRRKRVEEKKKDLQGVLNKYLAIK
HLINRNSRGLNYKPAISFPFIVVSTPDIPKNSMSIKVNSNATSLHLKLAKPISLFGDMDI
LLSLSLHKLSLASLLQYLPSKDLLNYCSIQDY


>SteCoe_27681(CDS)
ATGGAAAAGAACATACCACATCATATTTCCAAAATAATAAACGAACTGCATGAAGAAAAT
AACAAAGAAGAAGTCCTAATAAGGTACTCATTTTTATTGTGTAAGGACGTGAGCTTAATG
CAGATATACTTGGAGTTAGGATTTTGTTTGAAATCAAACTCATTTACCCGTTCAGTCAAT
ACAGCACAAGTTTTGTCACTTTTCAGTCAGGAATATGGTATACAACAACACAATATAGAC
AATTACTTAGCAAATGCCCCTGTTTCAGCGGATAATGATAGTGAAATGCGCCAGGAGCTG
TTGAGGTTTTTTTATGATCAAGGAATCAATGAAATTGCTTCTAGTGTTGACCTAGGATTG
GAAATACCTGAAGATAATACCCTTGCAGCTATGTGGCAAGATTATACACCTCAGAGTAAG
TCACAACAATTTTCAACACCTAAACCTAAAAAATTCCATAAGACTCCAAGCACACAGGCT
ACAAGATATCTTACACCCTCACCACTTAATACCCCTTATTCGGAAGAGTCAGAAATGGAA
ACCCCGAGATCTACTAGAGGTTTAAAGCACCTTACAACACTAGTTAAACACCTTGTATGT
AAGCACCAGCCCACATCTTTTAAAAATGTGGCTGTAAAGCTAATAGACGAACTAATCGTG
ACGGACGGTCCTGATCGACTCAAAGAAGAAAAAAATGTCAGACGTCGAGTTTACGACGCA
ATAAACGTTCTGATCGCCGCCGAGGTCCTGGAACGCAACGGAAGAAACGTCTCCTGGAAA
GAAAAATGGGACAGCGTCGAAATCGACATGCGTAAAACTGAAACAGAAAAGCGCCGTAAG
CGTGTAGAAGAAAAGAAAAAAGATCTTCAAGGTGTTCTCAACAAATACCTAGCAATAAAA
CATCTAATAAACCGGAATTCCCGTGGTCTTAACTACAAGCCAGCTATTAGTTTTCCTTTC
ATTGTAGTCTCAACTCCAGACATCCCAAAAAACTCCATGTCCATAAAAGTAAACTCGAAC
GCTACATCTTTACACCTAAAACTTGCAAAACCAATAAGTCTCTTTGGAGACATGGATATC
TTATTATCTTTATCATTACATAAACTGAGTCTTGCTAGTCTTCTTCAATATCTCCCAAGT
AAAGATTTATTAAATTACTGTTCTATTCAAGACTACTAA