Identifiers and Description

Gene Model Identifier

SteCoe_27694

Standard Name

None

Aliases

None

Description

Pkinase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003534501.0806392777072785e-30Protein kinase domain containi
ng protein. Sequence similarit
y to the CAMKL protein kinase
family (Eisen et al., 2006)."
Oxytricha TrifallaxContig21451.0.g871.0806392777072785e-30Protein kinase domain

Saccharomyces CerevisiaeYDR477W2.1151310375910805e-19AMP-activated serine/threonine
protein kinase; found in a co
mplex containing Snf4p and mem
bers of the Sip1p/Sip2p/Gal83p
family; required for transcri
ption of glucose-repressed gen
es, thermotolerance, sporulati
on, and peroxisome biogenesis;
involved in regulation of the
nucleocytoplasmic shuttling o
f Hxk2p; regulates filamentous
growth in response to starvat
ion; SUMOylation by Mms21p inh
ibits its function and targets
Snf1p for destruction via the
Slx5-Slx8 Ubiquitin ligase
WormBaseWBGene000039162.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27694(Protein)
MEENSNPKSVTIFLNGKLDKKCEVKLYKRLTVTDIIQGCKEKLSLNNHIKCKLLDSRGEE
LSDDDLEFINNEEPLFLSQGEKFAKSSSMAIYQEIRKLGQGGFGTVYLYRSKLTNKEVAI
KFVDLRKIFSPQDVQRLFSEISILRGLKHRNIVDLIDVFDLENKSCFVMEYCSGGELKEY
VQNSGPLSEKEVYRIVIQIVDAIRYCHNSSIVHRDLKLENILFLRPSHKTVKIVDFGISG
MFFLGKASENERSDAGSLHYIAPEVLTRSDNRANPALDIWSLGCIIYAMLTKTLPFLGKT
RKEIMSKIINCEYQPLPTTISKPWHKLIKGMLRKRPDSRWDMIRISDHLFKYKDLENVDV
SEDSFEKISKIVPAKSNGFFNVRRDRGKTPDKANAIKAIRKVTPNHCKRNNSNTPPEPGI
LNRRATNIEKAVPLRFKNFK


>SteCoe_27694(CDS)
ATGGAAGAAAATTCGAATCCGAAGTCTGTTACGATTTTCTTAAATGGAAAACTAGACAAA
AAGTGTGAAGTAAAACTCTACAAGAGACTAACCGTCACTGATATAATCCAAGGTTGTAAA
GAAAAATTAAGTTTGAACAATCATATAAAATGTAAACTACTAGATTCTAGAGGAGAAGAA
CTATCAGATGATGATCTAGAATTTATCAACAATGAAGAACCTCTATTTTTATCTCAGGGT
GAAAAGTTCGCTAAAAGTTCTAGCATGGCCATTTATCAAGAAATTAGGAAACTAGGTCAA
GGTGGTTTTGGGACTGTTTATTTATATAGAAGCAAATTGACTAATAAAGAAGTAGCAATA
AAATTTGTAGACCTAAGGAAAATCTTCAGTCCCCAAGATGTGCAGAGGCTATTTTCAGAA
ATCAGCATACTACGAGGATTAAAACATAGAAACATAGTTGATTTAATTGATGTTTTTGAT
CTTGAAAACAAAAGCTGCTTTGTTATGGAATATTGTAGTGGTGGGGAGCTTAAAGAATAT
GTGCAAAATTCAGGGCCTCTTTCTGAAAAAGAAGTATACCGTATTGTCATTCAAATTGTT
GATGCTATTAGGTACTGTCACAATTCTTCAATTGTCCATAGAGATTTGAAACTAGAAAAC
ATCCTTTTTTTAAGACCCTCACACAAAACTGTGAAAATCGTCGATTTTGGTATAAGTGGG
ATGTTTTTCCTTGGCAAAGCATCAGAAAATGAAAGAAGTGATGCAGGGTCACTACACTAT
ATTGCCCCAGAAGTCTTAACTCGTAGTGACAACAGAGCAAATCCAGCTTTAGACATTTGG
AGCTTAGGATGTATCATATACGCAATGCTAACAAAAACCCTACCTTTTTTAGGAAAAACC
AGAAAAGAAATCATGTCCAAAATAATCAATTGTGAATATCAACCATTACCTACAACAATA
AGTAAACCATGGCATAAACTCATAAAAGGGATGCTTAGGAAACGTCCTGATTCCAGATGG
GATATGATAAGAATAAGCGATCATTTATTTAAATACAAAGATCTTGAAAATGTTGATGTA
AGTGAAGATTCTTTTGAAAAAATCTCAAAAATTGTTCCTGCTAAAAGCAATGGTTTTTTT
AATGTCAGACGAGACCGGGGAAAAACCCCTGATAAAGCAAATGCGATTAAAGCTATAAGA
AAAGTTACCCCAAATCATTGCAAGAGAAATAACTCAAACACCCCACCTGAGCCTGGGATT
TTGAATAGAAGGGCGACGAATATTGAAAAAGCTGTTCCTTTAAGATTTAAAAATTTTAAA
TAA