Identifiers and Description

Gene Model Identifier

SteCoe_27893

Standard Name

None

Aliases

None

Description

PI3 kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7655.0.g671.1677812485237086e-60Phosphatidylinositol 3- and 4-
kinase

Tetrahymena ThermophilaTTHERM_006493805.166420632837861e-55A class III phosphatidylinosit
ol 3-kinase involved in the nu
clear degradation events of Pr
ogrammed nuclear death (PND)
Saccharomyces CerevisiaeYLR240W3.392270193026015e-47Phosphatidylinositol (PI) 3-ki
nase that synthesizes PI-3-pho
sphate; forms membrane-associa
ted signal transduction comple
x with Vps15p to regulate prot
ein sorting; activated by the
GTP-bound form of Gpa1p; a fra
ction is localized, with Vps15
p, to nuclear pores at nucleus
-vacuole junctions and may fac
ilitate transcription elongati
on for genes positioned at the
nuclear periphery
WormBaseWBGene000069322.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_27893(Protein)
MSFKYYRHEDITQQLYIKLTKFTDPKMLIDIYDDKTSPIATFVAVVSLESENRSIYKSSQ
VLVSIPNDSVLGCFTTPLCINDLDKDITIKIEIFSTTSSPNIPVSTTRLSLFGEYASKYN
KTTTPVPGHMLRQGRYKLVLDSETGVQDAAYYDEIFNLTTNLEKFDNKEYERIDWIDDKS
VAMVHKRIVEICTECNLALIEVELPKFSLPVKYEEIPYSDEPREMANLGYKLWIVPDFEL
INQRSNPMAEQFSRLDRVEAIDSKDLRPDEETKDLLSKIICLPDHNPLEEEQMALIWKYR
YSLVQDKYALTKFLHAVHWENHEEEKTAIELMHIWEKIDKEDALHLLSYKFAANNHYSNN
VSKGISEVRKYAVNILKKCTPNEVSSILLQLVQALRYEDYKDSPLRTLLLQNAIENRDIA
ISLYWYLQVESQGPAGIVTDQYVSFFEELKRALKEKSNETMNIINTQVDLKQRLLEISAQ
IKKSKRDTSNIEKKKQKLRTLLDQYGLRSFSEKVPSFLDTYLMLLGTKPEQSTVFMSKQY
PIKIGFLLEDQTQEYGMLFKNGDDLRQDQLIIQIIRLMDKLLKDVNLDMCLKPYNVLATS
MKDGFVEFVQNSSTIYDRIQKKQSLGNYLKENQANNPDITDTFIKSCAGYCVITYLLGIG
DRHLENLMVDNKGHLFHIDFGFILGKDPKPKPPPMKLCKEMVEAMGGENSAGYNTFKTKC
VEVFLQLRKHCKLIVNLFYLMIDSNLSGMSGNAIKIIDKLYDRFYINLSSEEAEKCFLGL
ITESVNALMPQIMEKIHVWANYWKRI


>SteCoe_27893(CDS)
ATGTCATTTAAGTATTATCGTCATGAAGACATAACGCAGCAGCTATATATCAAACTGACA
AAGTTTACTGACCCAAAAATGCTCATTGATATCTATGATGATAAAACTTCCCCAATTGCA
ACTTTTGTCGCAGTAGTTTCTCTTGAATCTGAGAACAGGAGTATATACAAATCTTCACAA
GTTTTAGTTTCAATACCTAATGATTCTGTATTAGGGTGCTTCACAACACCTTTATGCATA
AATGATTTAGACAAAGATATTACAATAAAAATCGAAATCTTCAGCACAACATCATCACCA
AATATACCAGTGAGTACTACTAGGCTTAGTTTGTTTGGAGAGTATGCTTCGAAATATAAT
AAAACAACTACACCTGTTCCTGGACATATGTTGCGTCAAGGTCGATACAAATTAGTACTT
GATAGTGAGACTGGGGTTCAAGACGCAGCATATTATGATGAAATTTTTAATCTCACAACA
AATCTTGAAAAATTCGACAACAAAGAATATGAGAGAATAGACTGGATTGATGATAAAAGT
GTAGCAATGGTCCACAAAAGGATCGTAGAAATATGTACAGAATGCAATTTAGCCCTAATA
GAAGTTGAACTGCCAAAATTTTCTCTTCCAGTGAAATACGAAGAAATCCCATATAGCGAT
GAGCCAAGAGAAATGGCCAATCTAGGTTATAAGCTCTGGATTGTCCCAGACTTTGAACTT
ATAAACCAACGTTCAAATCCAATGGCTGAACAGTTTTCAAGACTTGATCGTGTTGAAGCT
ATTGACAGTAAAGATTTACGACCAGATGAAGAAACTAAAGATTTATTAAGCAAAATCATA
TGTTTACCAGACCATAATCCATTAGAAGAAGAACAAATGGCTTTGATATGGAAATATAGA
TATTCTCTTGTACAAGATAAGTATGCTTTAACGAAATTCTTACATGCTGTTCATTGGGAA
AATCATGAAGAAGAAAAAACAGCAATTGAACTTATGCATATATGGGAAAAAATTGATAAA
GAAGATGCTTTGCATTTGCTTAGTTATAAATTTGCAGCGAATAATCATTATTCAAATAAT
GTTAGCAAAGGAATTAGTGAGGTTAGGAAATATGCGGTAAATATATTGAAGAAATGTACG
CCTAATGAGGTATCGAGTATTTTATTACAGTTAGTACAAGCGTTAAGATATGAGGATTAT
AAGGATTCGCCATTGAGAACACTGTTATTACAAAATGCTATTGAGAATAGAGATATCGCA
ATATCTTTGTATTGGTATTTACAAGTTGAAAGCCAAGGACCTGCTGGTATTGTTACCGAC
CAATACGTTTCCTTTTTCGAAGAACTAAAACGTGCTCTAAAAGAAAAATCCAATGAAACA
ATGAATATAATCAACACCCAAGTCGACCTTAAACAACGTCTTCTCGAAATTTCAGCCCAA
ATAAAAAAAAGCAAACGAGACACTTCCAACATTGAAAAGAAAAAACAAAAGCTCAGAACC
CTTTTAGATCAATATGGTCTCCGTTCTTTCTCAGAAAAAGTGCCAAGTTTTCTAGATACA
TATCTTATGCTTTTAGGTACAAAACCTGAACAATCAACAGTGTTTATGAGTAAACAATAC
CCAATAAAAATAGGTTTTCTCTTAGAAGACCAAACACAAGAATATGGCATGTTATTCAAA
AATGGTGATGATCTTCGTCAAGATCAGCTTATAATCCAAATAATCAGACTTATGGATAAG
CTTTTAAAAGATGTGAACTTAGACATGTGCTTAAAACCCTATAACGTCTTAGCAACAAGT
ATGAAAGATGGTTTTGTAGAATTCGTCCAAAACTCCAGTACAATCTATGACCGGATCCAA
AAAAAACAATCATTAGGTAACTATCTTAAAGAAAACCAAGCTAATAACCCAGACATAACT
GATACATTTATTAAAAGCTGTGCAGGATATTGTGTTATTACGTACCTTCTTGGTATTGGT
GATCGTCATCTTGAAAACCTTATGGTCGATAATAAAGGTCATTTATTTCATATAGATTTT
GGGTTTATTTTAGGTAAAGATCCAAAACCTAAACCTCCACCTATGAAACTTTGTAAAGAA
ATGGTTGAAGCTATGGGTGGGGAAAATTCTGCTGGATATAATACTTTTAAGACTAAATGT
GTTGAAGTGTTTTTACAGCTTCGTAAACATTGTAAACTTATTGTGAATCTGTTTTATTTG
ATGATTGATTCGAATTTATCTGGAATGTCAGGAAATGCTATTAAGATTATCGATAAACTT
TATGATAGGTTTTATATTAACCTTAGTAGTGAAGAAGCGGAAAAATGCTTTTTGGGGCTG
ATTACGGAAAGTGTGAATGCGTTGATGCCGCAGATTATGGAGAAGATACATGTGTGGGCG
AATTATTGGAAGAGGATTTAA