Identifiers and Description

Gene Model Identifier

SteCoe_28184

Standard Name

None

Aliases

None

Description

Ribosomal_S2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig845.1.g56.054601895401186e-39Ribosomal protein S2

Tetrahymena ThermophilaTTHERM_005226301.3336148155022614e-34Homolog of yeast RPS0, human R
PSA, bacteria RPS2
Saccharomyces CerevisiaeYGR214W1.3336148155022614e-34Ribosomal 40S subunit protein
S0A; required for maturation o
f 18S rRNA along with Rps0Bp;
deletion of either RPS0 gene r
educes growth rate, deletion o
f both genes is lethal; homolo
gous to human ribosomal protei
n SA and bacterial S2; RPS0A h
as a paralog, RPS0B, that aros
e from the whole genome duplic
ation;
WormBaseWBGene000044692.9374821117108028e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28184(Protein)
MNRLRKQQKDEDIQLLLAVKAHLGTSNTTEQMKRYLWSRKPDGSFLINLGKTWEKLQLAA
RAIVAVENPKDVVVISARPYGQRAVLKFSQYTETNYFANRWTPGTLTNQNTPKFMEPRLV
LVTDPRTDYQALQEASYMNIPTIALCDTDSPLTYVDIAIPCNNKAKLSIAMVYWLLAREV
LYLRGTIDRASKWDVFVDLFIWRDIEAEEKKDKDEKLASAKSVKKVKEEEDWGHAGEEVE
ETEVKTEEKPADQWEEQTGW


>SteCoe_28184(CDS)
ATGAACCGGCTTAGAAAGCAACAAAAAGATGAAGACATCCAGCTGCTCTTAGCCGTGAAA
GCTCATCTAGGAACTTCCAACACAACCGAGCAAATGAAAAGATATCTTTGGTCCCGCAAG
CCAGACGGTTCATTTTTGATAAATTTAGGTAAGACCTGGGAGAAATTACAACTTGCCGCT
AGGGCTATCGTTGCTGTCGAAAACCCTAAAGATGTTGTTGTGATTTCTGCAAGGCCCTAT
GGTCAACGTGCTGTTCTAAAGTTCTCTCAATATACAGAGACAAACTACTTTGCAAATCGT
TGGACACCAGGGACTCTTACCAACCAAAACACCCCCAAATTCATGGAGCCAAGACTTGTC
CTTGTAACTGATCCAAGAACTGATTATCAAGCTCTTCAAGAAGCTTCTTATATGAATATC
CCAACAATCGCTCTTTGTGATACAGATTCTCCTTTAACATATGTTGATATTGCCATCCCT
TGTAATAACAAAGCAAAATTATCAATCGCAATGGTATATTGGCTTTTAGCTAGAGAAGTA
CTTTATTTAAGAGGAACTATTGATAGAGCTAGCAAATGGGATGTATTTGTTGACCTTTTC
ATATGGAGAGATATTGAAGCTGAAGAGAAAAAAGATAAAGACGAGAAACTCGCTTCGGCT
AAATCTGTAAAGAAAGTTAAGGAAGAAGAAGATTGGGGACATGCTGGAGAAGAAGTTGAA
GAAACTGAAGTGAAAACTGAAGAAAAACCTGCGGACCAATGGGAAGAACAGACCGGGTGG
TAA