Identifiers and Description

Gene Model Identifier

SteCoe_28198

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002451800.0000000000006914400106940203Similar to Rab2; putative inte
rmediate compartment protein;
putative involvement in regula
ted secretion
Oxytricha TrifallaxContig80.0.1.g1110.0000000000006914400106940203Ras family

Saccharomyces CerevisiaeYFL038C0.0000000000018795288165390832Rab family GTPase; involved in
the ER-to-Golgi step of the s
ecretory pathway; complex form
ation with the Rab escort prot
ein Mrs6p is required for pren
ylation of Ypt1p by protein ge
ranylgeranyltransferase type I
I (Bet2p-Bet4p); binds to unsp
liced HAC1 mRNA; regulates unf
olded protein response (UPR) b
y promoting the decay of HAC1
RNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28198(Protein)
MVIRSRVALVGDATVGKSALALTLVNGPSGFPKNYTMTQGCEVYAKSMKVNNKPIEFQII
DTSGQTMYKDIVTDMIHRSTVIIFVYDITNQESFNSLQVWLKTVKDTLKEKVFYGVVVAN
KSDISERVIVRPQEGVAFARSNKCEFIETSALKQQDVEQLFTTIGEQVIRRYEDRVRRVS
TFT


>SteCoe_28198(CDS)
ATGGTAATAAGAAGCCGAGTTGCACTAGTAGGAGATGCTACAGTAGGAAAATCCGCCCTT
GCCTTAACCTTAGTAAATGGTCCAAGTGGTTTCCCTAAAAACTATACAATGACTCAAGGA
TGTGAAGTATATGCCAAAAGCATGAAGGTAAACAATAAACCAATAGAATTTCAAATAATC
GACACTTCAGGTCAGACAATGTACAAAGATATTGTCACAGATATGATACACAGATCTACT
GTTATTATATTTGTCTACGATATAACTAATCAAGAAAGCTTCAATTCTCTTCAAGTGTGG
CTAAAAACCGTCAAGGATACGTTGAAAGAAAAAGTTTTCTATGGAGTTGTGGTGGCTAAT
AAAAGCGACATTTCTGAACGTGTTATTGTCCGTCCACAAGAAGGTGTAGCTTTTGCTAGA
AGCAACAAATGCGAGTTCATCGAAACCTCAGCCCTTAAGCAACAAGACGTCGAGCAACTC
TTCACAACAATCGGCGAGCAGGTAATCAGAAGATACGAAGATCGAGTCCGAAGAGTTTCA
ACATTTACTTAA