Identifiers and Description

Gene Model Identifier

SteCoe_28302

Standard Name

None

Aliases

None

Description

ubiquitin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000067281.8048513878454153e-35
Oxytricha TrifallaxContig12690.0.g681.3336148155022614e-34Ubiquitin family

Tetrahymena ThermophilaTTHERM_003396203.6251409191435593e-34Homolog of Yeast RPL40; RPL40-
Ubiquitin fusion protein; Ribo
somal L40e family protein
Saccharomyces CerevisiaeYKR094C3.6251409191435593e-34Ubiquitin-ribosomal 60S subuni
t protein L40B fusion protein;
cleaved to yield ubiquitin an
d ribosomal protein L40B; ubiq
uitin may facilitate assembly
of the ribosomal protein into
ribosomes; homologous to mamma
lian ribosomal protein L40, no
bacterial homolog; RPL40B has
a paralog, RPL40A, that arose
from the whole genome duplica
tion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28302(Protein)
MQIFVKTLTGKTITLDVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAIEPTLMELARSYKCDKKICRKCYARLPLRAHNCRKRKCGHNSD
LRIKKKIKD


>SteCoe_28302(CDS)
ATGCAAATTTTTGTTAAGACACTCACAGGAAAGACGATAACTTTAGATGTAGAGTCTTCT
GATTCAATTGAGAACGTAAAAGCAAAAATCCAAGATAAAGAAGGAATTCCTCCTGATCAG
CAGCGCCTAATCTTTGCAGGAAAGCAGCTTGAAGATGGAAGAACCTTAGCTGACTACAAC
ATTCAAAAAGAATCGACTCTCCATTTGGTCTTAAGATTAAGAGGTGGTGCTATTGAACCT
ACTCTTATGGAACTTGCTCGTAGTTATAAGTGTGATAAGAAAATATGCAGGAAATGCTAT
GCCAGGTTGCCATTAAGAGCACACAATTGTCGCAAACGCAAATGCGGACACAACTCCGAC
TTGCGCATTAAGAAGAAAATTAAAGACTAA