Identifiers and Description

Gene Model Identifier

SteCoe_28304

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig2665.0.g973.975449735908647e-31WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_004259501.9287498479639178e-22Small-subunit processome prote
in involved in pre-18S rRNA ma
turation
Saccharomyces CerevisiaeYJL069C1.1548224173015786e-17Small-subunit processome prote
in involved in pre-18S rRNA ma
turation; part of a subunit of
the 90S preribosomal particle
capable of interacting direct
ly with the 5' ETS of the 35S
pre-rRNA; contains WD40 repeat
s
WormBaseWBGene000151040.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28304(Protein)
MSGIWEDQDDKTIQIDLSLSDRTKKLGKEPLISGAEYNQRLREKYASIYQTSWTTTESQN
SNLSKLFSTSKSILSDKSYSLQSTHLEIEQLQSANTNNYSKSVITTTEFQGNLLLIAGKD
KRLKIFEVPGETGENLKTSVCFKDLPITNARFCSEKVYVSGERPYFYIYDLAKEISQRVP
CIGKYTGQPLGKMKISPDSRYAVFLGNNGRMFQISTQSQKLVHEFKMNSPCKDLCFIDDN
IVACGGDEGDVYIWDLGMRDCVNRFSDEGTIKITCMDAKDNFLAIGSNTGVVNVYDRKSE
GFEGTNPKPIKAVMNLTTSVEGLCFNHNAEMLAMFSKWKKDAVKILHMQSLTVFANWPSF
RDHVKYPMACDFNATSELLTVGNDEGAALLYRLNHYTQ


>SteCoe_28304(CDS)
ATGTCTGGAATTTGGGAAGATCAGGATGACAAAACCATACAAATCGACCTTTCCTTATCC
GACAGGACAAAGAAACTAGGAAAAGAGCCTCTAATCTCAGGTGCTGAATACAACCAAAGA
CTTAGAGAAAAGTATGCATCCATATACCAAACCTCATGGACCACAACTGAGTCTCAAAAC
TCCAACCTTTCAAAGCTTTTTTCAACTTCTAAATCCATCCTCTCAGACAAATCCTACTCC
CTTCAAAGTACTCACTTAGAAATCGAGCAACTCCAATCAGCAAACACTAACAATTATTCC
AAAAGTGTCATTACAACAACAGAATTCCAAGGAAACCTCCTTCTTATCGCTGGTAAAGAT
AAGCGTCTTAAAATCTTTGAAGTCCCAGGCGAAACTGGGGAGAACCTTAAAACTTCAGTA
TGTTTTAAAGACCTTCCAATAACAAATGCTAGGTTTTGTTCAGAAAAAGTTTATGTTTCA
GGTGAACGTCCTTATTTTTATATATACGATTTAGCTAAAGAAATCTCACAACGTGTACCT
TGTATAGGAAAATATACAGGTCAACCTTTAGGTAAAATGAAAATTTCCCCAGATTCCCGC
TATGCTGTTTTTCTTGGTAATAATGGTCGGATGTTCCAAATTTCGACACAATCACAGAAA
CTTGTCCATGAATTTAAAATGAACAGTCCTTGTAAAGACTTATGTTTTATTGATGATAAT
ATTGTTGCTTGTGGAGGAGATGAAGGTGATGTTTACATTTGGGATTTAGGTATGAGAGAT
TGTGTTAATAGATTTTCTGATGAAGGGACTATTAAAATTACATGCATGGATGCAAAAGAT
AATTTCTTGGCTATTGGGTCAAATACTGGAGTTGTTAATGTTTATGATAGAAAAAGTGAA
GGTTTTGAAGGGACAAATCCAAAACCTATAAAGGCGGTTATGAATCTTACAACTTCAGTT
GAAGGGTTGTGTTTCAATCATAATGCAGAAATGCTTGCGATGTTTTCGAAGTGGAAAAAA
GATGCGGTGAAAATTTTACATATGCAGTCGCTGACTGTGTTTGCTAATTGGCCGAGTTTT
AGAGATCATGTTAAGTACCCTATGGCATGTGATTTTAATGCGACAAGCGAACTTTTGACG
GTTGGGAATGATGAGGGAGCAGCGCTTTTATATAGATTAAATCACTATACTCAGTAA