Identifiers and Description

Gene Model Identifier

SteCoe_28482

Standard Name

None

Aliases

None

Description

RNase_HII domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001422909.602680054508676e-24ribonuclease HII family protei
n
Oxytricha TrifallaxContig14329.0.g313.873997628687187e-21Ribonuclease HII

WormBaseWBGene000043831.0530617357553812e-20
Saccharomyces CerevisiaeYNL072W8.533047625744066e-17Ribonuclease H2 catalytic subu
nit; removes RNA primers durin
g Okazaki fragment synthesis a
nd errant ribonucleotides misi
ncorporated during DNA replica
tion; role in ribonucleotide e
xcision repair; homolog of RNA
se HI; related to human AGS4 w
hich causes Aicardi-Goutieres
syndrome

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28482(Protein)
MVYACCAWPICFRDAYSKKGFDDSKKLTEVKRDMLFDVIKFLPEVVYKTDVLSPEYISNS
MLGRHKISLNVISMESAEKLIQQLINDGINVREVYVDTVGTAETYQERLSNRFSGVQFKV
SAKADSLFPIVSAASIVAKVTRDSFIEDYKHTLGEIGSGYPSDPNTQGWLKKNLNPVFGF
PSKYVRISWRTCTDAMQDLPLVSWPEEMPITNERLHYFENIGIHDKFP


>SteCoe_28482(CDS)
ATGGTTTATGCTTGCTGTGCTTGGCCTATATGCTTTAGGGATGCTTACTCAAAAAAAGGA
TTTGATGACTCGAAAAAATTAACTGAGGTTAAGCGAGATATGCTATTTGATGTTATTAAG
TTTTTACCTGAAGTTGTTTACAAGACAGATGTATTGAGCCCGGAATATATTTCTAATTCC
ATGTTGGGAAGACATAAAATTTCTCTTAATGTGATTTCAATGGAAAGTGCTGAGAAGCTA
ATTCAACAACTAATAAATGATGGAATTAACGTGAGAGAAGTATATGTTGATACTGTTGGT
ACTGCAGAAACTTACCAAGAAAGACTTTCTAATAGATTTTCTGGTGTTCAATTCAAGGTT
TCTGCTAAGGCTGATAGCCTTTTTCCAATAGTTAGCGCAGCAAGTATAGTTGCTAAAGTT
ACTAGAGATAGCTTTATTGAAGATTACAAACATACTTTAGGTGAGATAGGATCTGGATAT
CCTTCTGATCCAAATACTCAAGGATGGCTTAAGAAGAACTTGAACCCAGTTTTTGGATTT
CCTAGCAAATATGTGAGAATTTCGTGGAGAACTTGTACTGATGCTATGCAAGATCTTCCT
TTAGTATCATGGCCTGAAGAAATGCCAATCACTAATGAACGTTTGCATTACTTTGAAAAC
ATTGGTATTCATGATAAATTTCCATAG