Identifiers and Description

Gene Model Identifier

SteCoe_28508

Standard Name

None

Aliases

None

Description

CH domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12034.0.g941.8048513878454153e-35EB1-like C-terminal motif

Tetrahymena ThermophilaTTHERM_005770602.6102790696677047e-23hypothetical protein
Saccharomyces CerevisiaeYER016W6.305116760146989e-16Microtubule plus end-tracking
protein; together with Kar9p m
akes up the cortical microtubu
le capture site and delays the
exit from mitosis when the sp
indle is oriented abnormally
WormBaseWBGene000133440.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28508(Protein)
MANENFGMMDGAFFVPKSELLAWVNNLLCLNVAKVEQMASAAAYCQIMDVMYPGCIPMSK
INWGAKYEHEFVNNYKLLQQAFDKQNVHKHIEVEKLIKAKYQDNLEFMQWFKRFFDLNCR
GGADYNAIERRKGAKTLWDAGERKAGAAPARTVEKPAEKPKGMSAPKPQAKPKPSGGGGD
EASEKQIAELRINCDTLEKERDFYFGKLRSIELFCDHFEGQDNQVVMDIQKILFATDDQE
VTVNEDGTVTVVSNEAGLI


>SteCoe_28508(CDS)
ATGGCGAACGAGAATTTCGGGATGATGGACGGGGCGTTTTTCGTCCCTAAATCTGAATTG
TTAGCATGGGTCAATAACCTTCTCTGCCTAAACGTCGCCAAAGTTGAACAAATGGCCTCA
GCAGCTGCTTATTGCCAAATAATGGACGTCATGTACCCAGGTTGTATTCCCATGAGTAAA
ATTAACTGGGGAGCAAAATATGAGCACGAGTTCGTAAATAACTACAAGCTTTTGCAACAA
GCATTTGATAAACAAAATGTGCACAAGCATATTGAAGTTGAAAAGCTCATAAAAGCTAAA
TATCAAGACAACCTTGAGTTCATGCAATGGTTCAAACGATTCTTTGATCTAAACTGTCGT
GGTGGGGCAGACTATAATGCTATAGAAAGAAGAAAAGGAGCTAAAACATTATGGGATGCT
GGGGAAAGAAAAGCTGGAGCAGCACCTGCGAGGACTGTAGAAAAACCAGCTGAAAAACCT
AAAGGAATGTCTGCACCAAAACCTCAAGCTAAGCCGAAACCTTCAGGTGGAGGAGGAGAT
GAGGCTTCTGAGAAGCAAATAGCTGAGTTGAGAATAAATTGTGACACTTTAGAAAAAGAA
AGAGACTTTTACTTTGGAAAACTCAGGAGTATTGAGCTGTTTTGTGATCATTTCGAAGGC
CAGGACAATCAAGTTGTTATGGACATACAGAAAATACTGTTTGCCACTGATGACCAAGAA
GTTACAGTCAATGAAGATGGGACAGTTACTGTAGTGTCGAATGAAGCAGGGTTAATTTAG