Identifiers and Description

Gene Model Identifier

SteCoe_2856

Standard Name

None

Aliases

None

Description

ATP-synt_F domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18550.0.g552.3195228302435696e-16ATP synthase (F/14-kDa) subuni
t

Tetrahymena ThermophilaTTHERM_000470706.305116760146989e-16V-type ATPase, F subunit famil
y protein
WormBaseWBGene000069180.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2856(Protein)
MATKAKILKDAENRHLIAVVADEDTVTGYLLTGIGERNHKGETNFIIVDDSTPSKAVEEA
FEKLINRQDIALILVAQKIADSMVRHLISGHTKMLPVILEIPSKDKQYLPQNDPELIKAA
KQLYGADRAIPMLAKEFVEGEEIDR


>SteCoe_2856(CDS)
ATGGCAACCAAAGCTAAAATCCTCAAAGATGCTGAAAATAGACACCTTATTGCTGTTGTT
GCTGATGAAGATACAGTCACTGGGTACCTTCTTACTGGTATAGGTGAACGTAATCATAAA
GGTGAGACTAATTTTATCATAGTTGATGATAGTACTCCAAGCAAAGCTGTTGAAGAAGCT
TTTGAAAAACTTATAAACCGACAAGATATTGCGCTTATACTTGTTGCTCAGAAAATTGCT
GACTCTATGGTTAGACATCTTATAAGTGGACATACAAAAATGCTTCCAGTGATATTAGAA
ATTCCAAGCAAAGATAAGCAGTATTTACCGCAAAATGATCCGGAGTTAATTAAAGCTGCT
AAACAACTTTATGGAGCAGATAGGGCAATACCCATGCTAGCTAAGGAATTTGTTGAAGGA
GAAGAGATAGATAGATAG