Identifiers and Description

Gene Model Identifier

SteCoe_28660

Standard Name

None

Aliases

None

Description

Cyclin

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001965906.47023492564546e-26Cyclin, N-terminal domain cont
aining protein; Putative mitot
ic cyclin; similar to Parameci
um CYC1 and CYC2
Oxytricha TrifallaxContig7999.0.g447.095474162284704e-23Cyclin, N-terminal domain

Saccharomyces CerevisiaeYPR119W3.1391327920480296e-17B-type cyclin involved in cell
cycle progression; activates
Cdc28p to promote the transiti
on from G2 to M phase; accumul
ates during G2 and M, then tar
geted via a destruction box mo
tif for ubiquitin-mediated deg
radation by the proteasome; CL
B2 has a paralog, CLB1, that a
rose from the whole genome dup
lication
WormBaseWBGene000008670.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28660(Protein)
MNYIDVCKENRSSSYKKSIEAARKALNSLSFNRLPARHSPQPVDKNPKHVSEYSREIIQN
LKQEELLYEAEKDFMKHQPDITSNSRAILINWLVSVHRYLKLLLETFYIAISLVDRFLQK
KSVTKYQLQLLGISALFLASKYEEIYPPEFSKFLKVCENAYTKAQIVLMEKEILKALDFK
LTVPTPWVFYQKFSESASLHHVEHNLGQYLIELTTLDMSMIRYRSSLKAAAAVLISQKHF
KKDSIWRLQQITGYAESELKECIHEMMATLQLARFNPLKAIREKYSSQDYDSVSVN


>SteCoe_28660(CDS)
ATGAACTACATAGATGTATGCAAAGAAAACAGGAGCTCAAGCTATAAGAAGTCAATAGAA
GCTGCAAGGAAAGCTCTAAATTCTCTAAGCTTTAATCGGCTTCCTGCCCGGCATTCCCCT
CAGCCGGTAGATAAAAATCCAAAACATGTGAGTGAGTACTCAAGAGAAATAATACAAAAT
CTTAAACAAGAAGAGCTTTTATATGAAGCTGAAAAGGATTTTATGAAACACCAGCCAGAC
ATAACTTCAAATTCAAGAGCTATTTTAATCAATTGGCTAGTGTCAGTTCACAGATATTTA
AAACTTTTGCTTGAAACATTTTATATTGCAATCTCACTTGTTGATAGGTTTTTACAAAAA
AAATCTGTTACAAAATATCAACTTCAGTTGTTAGGAATTTCTGCACTTTTTCTCGCATCC
AAATATGAAGAAATTTACCCGCCAGAGTTTTCAAAGTTTTTAAAAGTTTGCGAAAATGCT
TATACTAAAGCACAGATCGTGCTTATGGAAAAAGAAATCTTAAAAGCTTTGGATTTTAAA
CTTACCGTACCCACACCTTGGGTTTTTTATCAGAAATTCAGTGAAAGTGCATCTTTGCAT
CATGTAGAGCATAATTTAGGACAGTATCTCATAGAACTGACAACTTTAGATATGAGCATG
ATTCGGTATCGTTCATCACTTAAAGCTGCGGCAGCTGTTTTAATCTCTCAAAAACATTTT
AAAAAAGACTCGATCTGGCGATTACAACAAATAACAGGATATGCAGAATCTGAACTTAAA
GAATGCATACATGAGATGATGGCAACATTACAATTAGCAAGATTTAATCCACTAAAGGCA
ATAAGAGAAAAATATTCTTCACAAGATTATGATTCAGTGTCAGTGAATTAA