Identifiers and Description

Gene Model Identifier

SteCoe_28688

Standard Name

None

Aliases

None

Description

Proteasome domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006335308.194012623990515e-4020S proteasome core beta subun
it 2
Oxytricha TrifallaxContig17526.0.g728.985825944049381e-37Proteasome subunit

Saccharomyces CerevisiaeYOR157C9.854154686111257e-34Beta 2 subunit of the 20S prot
easome; endopeptidase with try
psin-like activity that cleave
s after basic residues; synthe
sized as a proprotein before b
eing proteolytically processed
for assembly into 20S particl
e; human homolog is subunit Z
WormBaseWBGene000039482.1705220113036395e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28688(Protein)
MEYLETLPTEGFNTDLMSRNIELEAQGLKPKFMKTGTTIAGLMFNGGVVIGADTRATSGS
TVLDKMCEKLHYIAPNMYCAGAGTAADTQHVNRQISQELALLRLNTGRESRVITAVTRLS
EHLFQYQGHIGAYLILGGVDINGPQLFGISADGSFKHQPYTTLGSGSLAAMSVFETEYRD
GMTKEEAMEVVRRAIEAGVFNDLGSGSSVDLVIIEKDKVDYRRTYRDYNRKAENSGFEVN
FPRGVTPVKNTYQLVVQEVPMEIDS


>SteCoe_28688(CDS)
ATGGAGTATCTGGAAACTTTACCAACAGAAGGGTTCAATACTGACCTTATGTCTAGAAAC
ATAGAACTTGAAGCTCAAGGTTTAAAGCCTAAGTTTATGAAAACTGGGACAACAATAGCT
GGGCTTATGTTTAATGGAGGTGTAGTCATAGGAGCTGATACTCGAGCAACTTCAGGTTCA
ACAGTTCTTGATAAAATGTGTGAAAAACTTCATTATATAGCACCAAATATGTATTGTGCT
GGAGCTGGAACAGCAGCAGATACTCAACATGTGAATAGGCAGATTTCTCAAGAATTAGCT
TTACTTAGACTTAATACAGGTAGAGAAAGCCGTGTTATTACTGCAGTAACAAGGCTTAGT
GAACATTTGTTTCAATATCAGGGGCATATAGGTGCTTATTTGATATTAGGTGGTGTTGAT
ATTAATGGACCACAATTATTTGGCATATCTGCTGATGGAAGTTTTAAACATCAACCTTAT
ACAACTTTAGGCTCTGGAAGCTTAGCGGCTATGAGTGTTTTTGAAACTGAATATCGAGAT
GGGATGACTAAAGAAGAAGCTATGGAAGTTGTGAGAAGGGCTATTGAAGCTGGAGTTTTT
AATGATCTTGGTAGTGGTAGCAGTGTTGATTTAGTGATTATTGAAAAAGATAAAGTTGAT
TATAGACGCACGTATAGAGATTATAATAGGAAAGCAGAAAATAGTGGCTTTGAGGTGAAC
TTTCCTCGTGGTGTTACTCCTGTCAAAAATACTTATCAACTTGTTGTTCAAGAAGTCCCT
ATGGAAATAGATAGTTAA