Identifiers and Description

Gene Model Identifier

SteCoe_28701

Standard Name

None

Aliases

None

Description

Arg_tRNA_synt_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006572709.964733010103672e-77arginyl-tRNA synthetase family
protein
Oxytricha TrifallaxContig21633.0.g195.440559879258653e-75tRNA synthetases class I (R)

WormBaseWBGene000046795.814040485895939e-62
Saccharomyces CerevisiaeYDR341C2.3802664086944007e-26Arginyl-tRNA synthetase; the a
uthentic, non-tagged protein i
s detected in highly purified
mitochondria in high-throughpu
t studies; YDR341C has a paral
og, MSR1, that arose from the
whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28701(Protein)
MKSLIGVLKDIISQAVSASIPISEPAVVTSAAAKFNMDFVSPIALTIFNKQKSSGCFGIK
NAKDLATLIHSNIQSNPIVNQVEIATNGFLNIYINHEFIAGQITDLARGNFTLDIGLVKS
KILVDFSSPNIAKEMHVGHLRSTIIGDAICRCLEFLGHDVARVNHLGDWGTQFGMLLCYL
ADKYPNWETSAPDISNLEEFYKAAKKEFDVNPEFKERARLRVVDLQSGEESAMKAWRYIF
KVSREYLQIVYDRLDIKIEDFGESFYNPMLKGIRDELVERGFAVESEGALIFNVEGHSTP
LMVQKTDGGYGYDSTDLAAVKHRLVTLGMQRAIYVTDSGQSTHFYALFDAAKTVGWHNPP
STRLDHAGFGVVLGPDGKKFKTREGGTVKLINLLNEAHDRAKAQLEKREQDPSIGNRTHL
TPQDFEIAAEVLGMAAIKYFDLKQNRISTYAFSFDKMLDPKGNTAVYLIYAYARICSILE
KLGEEVISESLSSTCILADKTEKNLALCICRLPDVLETVVDELALNKLCDLLYEISTKFS
EFYTKCRVIGSAEQSSRIQLCIATKIVMKKIFNLLGIEPIEKI


>SteCoe_28701(CDS)
ATGAAGTCTCTAATAGGAGTGCTAAAAGATATCATATCTCAGGCTGTATCAGCATCAATT
CCAATATCTGAACCAGCCGTTGTGACTTCAGCAGCAGCCAAATTCAACATGGACTTCGTT
TCACCAATAGCTCTGACAATTTTCAACAAGCAAAAATCATCAGGATGTTTCGGCATAAAA
AATGCAAAAGACTTAGCAACACTTATTCATTCAAATATTCAATCAAATCCAATAGTAAAC
CAAGTAGAAATCGCGACAAATGGATTTTTGAATATATACATAAACCATGAATTCATCGCA
GGACAGATAACAGATTTAGCTCGTGGGAATTTTACTTTAGACATAGGTTTAGTAAAATCA
AAAATTCTTGTAGACTTTTCAAGCCCTAATATCGCAAAAGAAATGCATGTAGGGCATTTA
AGGTCAACAATTATTGGTGATGCTATTTGCAGATGTTTAGAATTTTTAGGACATGATGTT
GCTAGAGTTAATCATCTTGGAGACTGGGGAACACAATTTGGTATGCTTCTTTGTTATTTA
GCTGATAAGTATCCTAATTGGGAAACCTCTGCACCTGATATTTCTAACTTGGAAGAGTTT
TATAAAGCAGCTAAAAAAGAATTTGATGTGAATCCTGAATTTAAAGAAAGAGCTAGACTT
AGAGTTGTGGATTTACAGTCTGGAGAAGAGTCTGCGATGAAAGCTTGGAGGTATATTTTT
AAAGTGTCAAGAGAGTATTTACAGATTGTGTATGATAGACTTGATATTAAAATTGAAGAC
TTTGGAGAATCGTTTTATAATCCAATGCTTAAAGGGATTAGAGATGAACTTGTTGAGAGA
GGATTTGCTGTTGAAAGTGAAGGCGCACTGATATTTAACGTTGAAGGTCATTCAACACCT
CTTATGGTTCAAAAAACAGATGGAGGTTATGGCTATGACTCAACAGATTTAGCAGCCGTA
AAACATAGACTAGTAACCTTAGGTATGCAACGGGCAATTTACGTGACTGATAGTGGTCAA
TCAACTCATTTCTATGCATTATTCGATGCAGCCAAAACAGTTGGTTGGCATAACCCACCT
TCAACTCGTTTAGATCATGCAGGTTTCGGTGTTGTCCTTGGCCCAGATGGCAAAAAATTC
AAAACCCGTGAAGGAGGTACGGTCAAACTTATAAACCTCTTAAATGAAGCTCATGATAGA
GCTAAAGCCCAATTAGAAAAAAGAGAACAAGATCCCAGTATTGGAAATCGTACTCATTTA
ACCCCTCAAGACTTTGAAATAGCAGCTGAAGTCCTCGGTATGGCAGCTATTAAATACTTT
GACCTTAAGCAAAATCGTATTTCTACATATGCTTTTTCATTTGACAAAATGCTTGATCCT
AAAGGTAACACTGCAGTTTATCTTATATACGCATATGCTAGAATATGTTCAATTTTAGAA
AAACTTGGTGAAGAAGTTATATCTGAAAGTTTATCTTCAACTTGTATCCTTGCTGATAAA
ACTGAAAAGAATTTAGCTTTATGTATTTGCAGACTTCCTGATGTTTTAGAAACTGTTGTA
GATGAACTTGCGCTTAATAAACTATGTGACCTTCTTTATGAAATTAGCACAAAATTCTCT
GAGTTTTATACTAAATGTAGAGTTATTGGAAGTGCTGAACAGTCAAGTAGAATCCAGTTA
TGCATAGCTACCAAAATCGTTATGAAGAAGATTTTCAATTTATTAGGCATAGAACCTATA
GAAAAAATTTAA