Identifiers and Description

Gene Model Identifier

SteCoe_28760

Standard Name

None

Aliases

None

Description

Ku_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9679.0.g872.138865964899539e-62Ku C terminal domain like

Tetrahymena ThermophilaTTHERM_004924604.590938473882946e-48Ku70/Ku80 beta-barrel domain c
ontaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28760(Protein)
MAGKEAVAVIIDVGKTMGKELDGKVKLETAIEATKLLLQQKLLLSKSHEVGIVLMGSEDT
ANELAENYGGYEHVSIIQEMDVPTLDSMIMVSALESSNQTGDILDAIVVAVNMIENKIGK
KKFKKRMFILTDGNCTANAPDQLQDIIDQINIQEIRVNVIGIGFGEEYLRQTDQQKNTFA
VLQTIVASVQGVIYPSKTAMQIYKQFRKRSVYPVAKYKGPLDLGLGYRIDICIYGKTKEE
PLPSLKKHSTVVEYTEEAKEGLVKMSREAALEDDPTSTVVDPQDIIKAYFYGKSVVPVTA
DDEELLKYPCRKCLKVLGYLSSSAIPRHYFMSGVDMILPNPSESDEIAFAAYVQALYQRD
DVVLARYSYRDYTSVRLVVLTPCIKPELICLWLNFLPTSEDARDFPFADLTESTTEQNKA
TEDFILALSLDKTQDEDEKLKPSSLFSPTLQYFYQCLTFRAENPQAQLPELDLNIQKYIC
PDKEMFENAQKQCQKFAEAFILKPVETVKKEKKFYVDLLKGKPEDDKDEEDVGKIGEINP
VQDFYDMIHDRKADKVDLAIDQMEELILKLLDRDFKGNMYKKAMDCLKALREGCKNEPEF
SGFNTFLLVKIKGLQHIHVDFWNYMVDEGVSLITHDENKSSKITERESKNFLVKIQASQP
KISSMDLDDIE


>SteCoe_28760(CDS)
ATGGCTGGAAAAGAGGCGGTGGCTGTAATAATCGACGTGGGTAAAACCATGGGCAAAGAA
CTGGATGGTAAAGTTAAGCTCGAAACAGCAATCGAAGCAACAAAACTCTTACTTCAACAA
AAACTCCTTTTATCTAAATCTCATGAAGTCGGCATTGTACTCATGGGATCAGAAGATACG
GCCAACGAGTTGGCCGAAAACTATGGAGGATATGAACATGTATCAATAATCCAAGAGATG
GATGTACCAACTTTAGATTCAATGATAATGGTCTCAGCTTTAGAAAGTTCTAATCAAACA
GGGGATATTTTAGATGCAATAGTTGTGGCTGTGAATATGATTGAAAATAAAATCGGTAAG
AAAAAATTCAAAAAACGAATGTTTATATTAACTGATGGGAATTGTACAGCTAATGCCCCT
GATCAATTACAAGATATAATAGATCAGATTAATATACAAGAAATAAGGGTTAATGTTATT
GGTATAGGTTTTGGTGAAGAATATTTAAGACAAACAGATCAGCAAAAAAACACATTTGCC
GTATTACAGACAATAGTAGCTTCAGTACAAGGTGTTATATATCCAAGTAAAACAGCAATG
CAAATATATAAACAATTTAGAAAAAGAAGTGTATATCCTGTAGCTAAATATAAAGGACCA
TTAGATTTAGGACTTGGTTATAGAATTGATATTTGCATATATGGGAAAACAAAAGAAGAA
CCTTTACCATCATTAAAAAAACATAGTACTGTAGTTGAATATACTGAAGAAGCTAAAGAA
GGACTTGTAAAAATGAGTAGAGAGGCAGCTTTAGAAGATGATCCTACAAGTACTGTTGTT
GATCCACAAGATATAATAAAAGCTTATTTTTATGGGAAATCTGTTGTCCCTGTAACTGCT
GATGATGAAGAGCTTCTTAAATACCCATGTCGTAAATGTTTGAAAGTTCTTGGATATTTG
TCTAGTAGTGCAATACCAAGGCATTATTTCATGTCAGGTGTTGATATGATTTTACCAAAC
CCATCAGAAAGTGATGAAATAGCTTTTGCAGCATATGTTCAAGCATTATATCAAAGAGAT
GATGTTGTTTTAGCTAGATATTCATATAGAGATTATACAAGTGTTAGACTTGTTGTCCTT
ACACCTTGTATTAAACCTGAACTTATATGTTTATGGCTTAATTTTCTCCCAACAAGTGAA
GATGCTAGAGATTTCCCTTTTGCTGATTTAACTGAATCTACAACTGAACAAAATAAAGCT
ACTGAGGATTTTATTTTAGCTTTATCTTTAGATAAAACTCAAGATGAAGATGAAAAACTT
AAACCAAGTTCATTGTTTAGCCCAACACTTCAGTATTTTTATCAATGTTTAACATTTAGA
GCTGAAAACCCTCAGGCTCAACTTCCAGAATTAGATCTTAATATACAAAAATATATATGC
CCAGATAAGGAAATGTTTGAAAATGCTCAAAAACAATGTCAGAAATTCGCTGAAGCTTTT
ATATTAAAACCTGTTGAGACTGTGAAGAAAGAAAAAAAATTCTATGTGGATTTACTTAAA
GGCAAACCTGAAGATGATAAAGATGAAGAAGATGTTGGGAAGATTGGAGAAATTAACCCG
GTACAGGATTTTTATGATATGATTCATGATAGAAAAGCTGATAAAGTGGATCTTGCAATA
GATCAAATGGAAGAACTCATATTAAAATTGTTAGATCGAGATTTTAAAGGAAATATGTAT
AAAAAAGCTATGGATTGTCTCAAAGCTCTTAGAGAAGGGTGTAAAAATGAACCGGAGTTT
TCTGGATTTAACACCTTTTTATTAGTAAAAATCAAAGGTTTACAACATATTCATGTAGAT
TTTTGGAATTATATGGTTGATGAAGGGGTGTCTTTAATAACTCATGATGAGAATAAATCA
AGTAAGATTACTGAGAGGGAAAGCAAGAACTTTTTAGTCAAAATCCAAGCAAGTCAGCCT
AAAATTTCATCGATGGACTTAGATGATATAGAATAA