Identifiers and Description

Gene Model Identifier

SteCoe_28767

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYMR190C9.462629465836378e-57RecQ family nucleolar DNA heli
case; role in genome integrity
maintenance; regulates chromo
some synapsis and meiotic join
t molecule/crossover formation
; stimulates DNA catenation/de
catenation activity of Top3p;
potential repressor of a subse
t of rapamycin responsive gene
s; rapidly lost in response to
rapamycin in Rrd1p-dependent
manner; similar to human BLM a
nd WRN proteins implicated in
Bloom and Werner syndromes; fo
rms nuclear foci upon DNA repl
ication stress
Tetrahymena ThermophilaTTHERM_010300002.572209372642415e-56ATP-dependent DNA helicase, Re
cQ family protein
Protein invo
lved in DNA joint molecule res
olution dHJ dissolution and cr
ossing over
Oxytricha TrifallaxContig17511.0.g636.991989996645917e-56DEAD/DEAH box helicase

WormBaseWBGene000193347.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28767(Protein)
MQKLEPEAGKQNTILQKVIEINRTVFKNNIFRPNQQEIILASLSDKDIFVCMPTGGGKSL
TFQLPAVINNGLTVVIMPLVSLIQDQVAHLNDLNISNRVIGAFKSKNSSNIFSEILADSS
VKIIFLTPEKISKSQKTCDFLNKIYKQGKLNRFAIDEAHCVSQWGREFRSDYLKLSMLRK
KFPNVPIITLTGTATEKVRKDVINVLKLKNPQVFLASFNRENLYYEVREKNTSKIVGEIT
EFIKTNHLKNSGIIYCISKKDCEKLAKDLKKEGIKSSYYHASMTDKKRSSNQVKWMEGKI
LVLVATIAFGMGIDKKNVRFVIHYAFPKSIENYYQESGRAGRDGHISDCLIFFSYSDKYK
HDRLIQKNKQTDRNFQELYTIMKYCENFTTCRRKIQLEYFGEYFDPIKCNKMCDNCRNKN
NETQEDCSETAKKILQVLANQPDGINTLAQLTGFLKGIKCKKNEDLTDFPGFGSMIDMKT
EDIGKVIRKLIYDDAINEKTVKCSKKFKMTKLELGSKSTEVLLGTMKIYLPVILKNKLNT
NDQVYKQNEQNTHVEKTQGNQQISNNSIYMQNNGNNIIMQIGKLRYNPPMQSTNNFQSIT
YIEKPRLSIDSWSSFKNKPFVPSSFFPKQRPSLEKAPFLSDDYIPRIPVTKDVELILDTP
VTVNQKSNDYELNDEQYEELKERLEIVRKKLSRISGKSIEEILSNDKLDKLSRTMQSEDI
QKEFTSEILYFQKVNQISIENSSAERFEFHTMRRFNEDSYKRLKFN


>SteCoe_28767(CDS)
ATGCAAAAGCTAGAGCCCGAAGCCGGTAAGCAAAACACAATTCTTCAAAAAGTTATTGAA
ATCAACAGGACAGTTTTCAAAAACAATATTTTCAGGCCAAACCAACAAGAAATCATCTTA
GCTTCTCTTTCTGACAAAGATATCTTTGTCTGTATGCCTACAGGTGGAGGTAAAAGCTTA
ACCTTTCAATTACCAGCTGTTATAAACAATGGTCTAACAGTAGTCATCATGCCATTAGTA
TCTTTAATCCAAGACCAAGTTGCTCATCTTAATGATCTCAACATCTCAAATCGAGTCATA
GGGGCATTCAAATCAAAAAATTCCTCAAACATTTTCTCAGAAATTCTTGCAGACTCATCA
GTCAAAATAATTTTCCTAACCCCAGAAAAAATCTCAAAAAGCCAAAAAACATGTGATTTC
CTTAATAAAATATACAAACAAGGTAAGCTTAATAGGTTTGCTATTGATGAAGCTCATTGT
GTTAGTCAATGGGGAAGAGAATTTCGTAGTGATTATTTGAAATTATCAATGCTTAGAAAA
AAATTCCCAAATGTGCCGATTATAACATTAACAGGAACAGCAACAGAAAAAGTTAGAAAA
GATGTGATAAATGTATTAAAACTAAAAAATCCTCAGGTTTTTTTAGCATCTTTTAATAGA
GAAAATCTTTATTATGAAGTCAGGGAGAAAAACACAAGTAAAATTGTTGGGGAAATAACT
GAGTTTATCAAAACAAACCATTTGAAAAACAGTGGGATTATTTATTGTATATCGAAAAAA
GACTGTGAAAAACTAGCAAAGGATTTGAAGAAAGAAGGTATCAAAAGTTCATATTATCAC
GCTTCGATGACAGATAAAAAAAGGTCATCAAATCAAGTCAAATGGATGGAAGGGAAAATT
TTAGTCTTGGTCGCCACAATAGCTTTTGGTATGGGAATCGACAAAAAAAACGTAAGATTT
GTCATCCACTACGCTTTCCCAAAATCCATAGAAAATTATTATCAAGAATCAGGTCGAGCA
GGTCGTGATGGGCATATATCCGATTGTCTTATTTTCTTCAGTTATTCAGACAAATACAAA
CATGATCGGCTTATTCAAAAAAACAAACAAACAGATCGTAATTTCCAAGAATTATATACA
ATAATGAAATACTGTGAAAACTTCACAACATGTCGACGGAAAATCCAACTTGAATACTTT
GGAGAGTATTTCGATCCTATAAAATGTAATAAAATGTGTGATAATTGCCGAAATAAAAAC
AATGAAACCCAAGAAGACTGTTCAGAAACTGCTAAAAAAATCCTCCAAGTCTTGGCAAAT
CAGCCTGATGGGATAAACACTTTAGCTCAATTGACAGGTTTTTTAAAAGGAATCAAATGT
AAAAAAAATGAAGACCTGACTGATTTTCCTGGATTTGGTAGTATGATTGATATGAAGACT
GAGGATATAGGCAAAGTTATAAGAAAACTTATTTATGATGATGCGATAAACGAAAAAACA
GTAAAATGTTCGAAAAAGTTTAAAATGACGAAATTAGAACTGGGTTCAAAAAGTACTGAA
GTGTTGTTAGGGACTATGAAAATATACCTTCCTGTTATACTTAAAAACAAATTAAATACT
AATGATCAGGTATATAAACAAAATGAACAAAATACTCATGTAGAAAAAACACAAGGAAAT
CAACAAATAAGCAATAATTCTATTTATATGCAAAATAATGGAAATAATATTATAATGCAA
ATAGGAAAACTTAGATACAATCCTCCAATGCAATCTACAAATAATTTTCAAAGCATTACT
TATATAGAAAAACCTCGTTTAAGCATTGATAGTTGGAGTTCATTTAAAAATAAACCTTTT
GTCCCATCAAGTTTTTTTCCTAAACAAAGACCTTCATTAGAAAAAGCTCCATTTCTCTCT
GATGATTATATCCCAAGAATCCCTGTTACTAAAGATGTTGAACTTATACTTGATACACCT
GTTACTGTAAATCAAAAATCTAATGATTATGAATTAAATGATGAACAATATGAGGAACTT
AAAGAAAGATTGGAAATTGTTAGAAAAAAACTTAGTAGGATTAGTGGGAAAAGTATTGAA
GAAATCCTTTCAAATGATAAACTTGATAAACTTAGTAGGACAATGCAAAGTGAGGATATA
CAAAAAGAGTTCACAAGCGAAATATTGTATTTTCAAAAAGTTAACCAGATTAGTATTGAA
AACTCTAGTGCTGAGAGGTTTGAATTCCACACAATGAGAAGATTTAATGAAGATAGCTAT
AAAAGGTTAAAATTTAATTAA