Identifiers and Description

Gene Model Identifier

SteCoe_28789

Standard Name

None

Aliases

None

Description

Methyltransf_11 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_011439005.900090541597061e-29tRNA methyltransferase
Oxytricha TrifallaxContig4316.0.g1052.6102790696677047e-232OG-Fe(II) oxygenase superfami
ly

WormBaseWBGene000075812.8625185805493937e-20
Saccharomyces CerevisiaeYML014W5.74952226429356e-19tRNA methyltransferase; cataly
zes modification of wobble bas
es in tRNA anticodons to 2, 5-
methoxycarbonylmethyluridine a
nd 5-methoxycarbonylmethyl-2-t
hiouridine; may act as part of
a complex with Trm112p; delet
ion mutation increases transla
tional infidelity, including a
mino acid misincorporation and
-1 frameshifting, and also co
nfers resistance to zymocin; n
ull mutant displays activation
of stress responses

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28789(Protein)
MLSYGKELEKEFVHTTYENIAKHFSDTRYKPWPKVDKFLHNLGPHSLVLDIGCGNGKYIH
SNPLTRIGTDMTQNLLEICSSRKFAVFRANCLSLPIQSYRFDAAISIAVIHHMSTIERRV
KALEEILRVLVINGKALIYVWAKEQDERNFDEQDVFVPWKSNKQDGDTFQRYYHVFVKGE
LEDLVQRATVDGCSFDIVESYYDRSNLCVILEKVRKN


>SteCoe_28789(CDS)
ATGCTTAGTTATGGAAAAGAGCTTGAAAAAGAATTTGTGCATACAACATATGAAAATATC
GCTAAGCATTTTTCTGACACTCGCTATAAACCCTGGCCCAAAGTAGACAAGTTTCTTCAT
AATCTTGGACCTCATTCACTAGTTCTTGATATTGGATGTGGCAATGGTAAATACATTCAC
TCAAATCCTTTAACTCGTATTGGAACTGATATGACACAAAATCTTCTTGAAATCTGTTCA
TCTCGTAAATTTGCCGTCTTTCGTGCGAATTGTTTAAGTCTTCCAATTCAATCTTATCGC
TTTGATGCTGCAATTTCTATAGCGGTAATTCATCATATGTCTACTATAGAAAGAAGAGTA
AAAGCACTTGAAGAAATTTTAAGGGTATTAGTTATCAATGGCAAAGCTTTAATTTATGTT
TGGGCTAAAGAACAAGATGAGAGGAATTTTGATGAACAAGATGTTTTTGTACCTTGGAAA
TCTAATAAGCAAGATGGGGATACTTTTCAAAGATATTACCATGTTTTTGTTAAGGGAGAA
CTTGAAGATTTAGTTCAGAGGGCTACTGTGGATGGGTGTAGTTTTGATATTGTTGAGAGT
TATTATGATAGGTCGAATTTGTGTGTTATATTGGAGAAAGTTAGGAAAAATTAA