Identifiers and Description

Gene Model Identifier

SteCoe_28804

Standard Name

None

Aliases

None

Description

JAB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002679901.368539471173853e-44Mov34/MPN/PAD-1 family protein
Oxytricha TrifallaxContig11141.0.g372.031092662734811e-42Maintenance of mitochondrial s
tructure and function

Saccharomyces CerevisiaeYOR261C3.6251409191435593e-34Essential non-ATPase regulator
y subunit of the 26S proteasom
e; has similarity to the human
p40 proteasomal subunit and t
o another S. cerevisiae regula
tory subunit, Rpn11p
WormBaseWBGene000044647.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28804(Protein)
MQKIEEVIVHPLVLLSVVDHYHRVAKETKKRVVGVLLGETYKGRLDVNNSFAVPFEEDPQ
DPKVWFLDHNYLETMFGMFKRINAREKIVGWYSSGPGVKVPDIQINESFKKYEANPIFVV
IDIQASETLELPAQAYVSKEEVNEEGSIVKNFLHLPTILGCSEPEEVGVEHLLRDVRDVA
ATSLATETQHKIAALKAMLTRIQTIQEYIDSVLSGGKANHEIFFKLQEAFNHLPDTNSLS
QEFAVNQNNTYLALYLASITRSVLSLHSLINNKSKV


>SteCoe_28804(CDS)
ATGCAAAAGATCGAAGAGGTCATTGTGCATCCCTTAGTACTTCTTTCAGTTGTCGATCAC
TACCATCGTGTAGCCAAAGAGACCAAAAAAAGAGTTGTAGGGGTGTTACTTGGGGAAACC
TATAAAGGTCGTCTTGATGTGAACAATTCTTTTGCAGTTCCATTTGAAGAAGACCCTCAA
GATCCTAAAGTTTGGTTTCTTGATCATAACTATCTTGAAACTATGTTCGGCATGTTCAAA
CGTATTAATGCTAGGGAAAAAATTGTTGGCTGGTACAGCAGTGGTCCAGGAGTCAAAGTC
CCTGACATACAAATAAACGAGAGTTTTAAAAAATACGAAGCAAATCCTATATTTGTTGTT
ATCGACATACAAGCTTCTGAAACTTTAGAGTTACCAGCCCAAGCATATGTGTCAAAAGAA
GAAGTCAATGAAGAAGGGAGCATTGTTAAGAATTTCCTACACCTACCAACAATCCTTGGG
TGTTCAGAGCCTGAAGAAGTGGGTGTTGAGCATCTACTCCGAGATGTCCGTGATGTAGCC
GCAACATCTTTAGCTACTGAAACCCAGCACAAAATAGCCGCATTAAAAGCAATGCTCACA
AGAATCCAAACAATCCAAGAATACATCGACTCAGTATTATCCGGAGGAAAAGCTAATCAT
GAGATTTTTTTCAAACTCCAAGAAGCCTTTAATCATTTACCCGACACCAACAGTTTATCC
CAAGAATTCGCTGTAAACCAAAACAACACTTATTTAGCTTTATATCTTGCAAGTATCACA
AGAAGTGTTTTATCTTTGCATTCACTTATAAACAATAAATCAAAAGTTTAG