Identifiers and Description

Gene Model Identifier

SteCoe_28813

Standard Name

None

Aliases

None

Description

Lactamase_B_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_0006974991.7587922024243116e-25kinase domain protein
Oxytricha TrifallaxContig13766.0.g881.9287498479639178e-22DNA repair metallo-beta-lactam
ase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28813(Protein)
MVKVPKINAIVDGFKYNSQLVCPNYIFFLTHMHSDHYNGLTPTWNRGPIYCSSETAKLVK
DLYPQVQGITSLELDVKHWITLDKNTNEGVNVTFIDANHCIGAVMILFQGDKCGNILYTG
DFRFIPSMLNHESLLDSSGQIINIDHLFLDNTFSDPEFIFPPQDICMQMVFNAIEENPES
DVWIKNECFGKEKLYVELAEKFKTLIVICPKMYRRICLLNLSPEKFTTNENEGYIRIVNT
EQMRGLNERNKNQISTIGIWLTGWMKHLVKHSENGVTTYKIPYSGHSNSEELKTFTRAIK
AKNTTFTSSCARKSKGNSEIVEETYSRKSDVYIPPTTPEILPKRRIQNPYSSHLKKTKKP
KVLGSKIQ


>SteCoe_28813(CDS)
ATGGTAAAAGTTCCGAAAATTAATGCAATTGTTGATGGATTCAAATATAACTCTCAACTA
GTCTGCCCAAACTATATTTTCTTCTTAACTCATATGCATTCAGATCATTATAATGGCTTG
ACACCAACTTGGAACCGAGGACCTATCTATTGTTCATCAGAAACAGCAAAACTTGTTAAA
GACCTTTACCCTCAAGTTCAAGGTATTACAAGCTTAGAACTTGATGTTAAACATTGGATA
ACTTTAGACAAAAACACAAATGAAGGTGTTAATGTAACTTTTATAGATGCTAACCATTGT
ATCGGTGCTGTAATGATACTTTTTCAAGGGGATAAATGTGGAAATATCCTTTATACCGGA
GATTTTAGATTTATACCTAGCATGCTTAATCATGAATCTCTTTTGGATTCATCAGGACAA
ATTATCAACATTGATCATTTGTTTCTTGATAACACTTTTAGCGACCCTGAATTTATTTTC
CCGCCACAAGATATATGCATGCAAATGGTTTTTAATGCTATTGAAGAAAACCCTGAAAGT
GATGTTTGGATAAAAAATGAGTGTTTCGGTAAAGAAAAACTTTATGTTGAGTTAGCTGAG
AAATTTAAAACATTGATTGTTATATGCCCTAAAATGTATAGAAGAATATGCCTTTTAAAC
CTAAGTCCTGAAAAATTTACTACAAATGAAAACGAAGGGTATATCCGAATAGTAAATACT
GAACAAATGAGAGGATTAAATGAAAGAAACAAAAATCAGATAAGCACAATTGGCATTTGG
CTTACTGGTTGGATGAAACACTTGGTAAAACATTCAGAAAACGGAGTGACAACCTATAAA
ATCCCATATTCTGGGCATTCGAACAGTGAAGAACTAAAAACTTTCACAAGAGCAATCAAA
GCGAAAAATACAACTTTTACATCATCATGTGCAAGAAAAAGCAAGGGCAACTCAGAAATT
GTTGAAGAAACATATTCAAGAAAATCTGATGTTTATATCCCACCAACCACACCAGAAATA
TTACCAAAACGCAGAATACAAAACCCTTACAGCAGTCATTTAAAAAAAACTAAAAAACCG
AAAGTTCTTGGTTCCAAAATACAATAA