Identifiers and Description

Gene Model Identifier

SteCoe_28836

Standard Name

None

Aliases

None

Description

Mpp10 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006227901.4251640827409352e-21Mpp10 protein
Oxytricha TrifallaxContig21586.0.g1000.000000000000004658886145103398Mpp10 protein

Saccharomyces CerevisiaeYJR002W0.00000000000009357622968840175Component of the SSU processom
e and 90S preribosome; require
d for pre-18S rRNA processing,
interacts with and controls t
he stability of Imp3p and Imp4
p, essential for viability; si
milar to human Mpp10p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28836(Protein)
MESFKELIGTIPDATYLLTPSTSLAERSLKTLEVLTESLQEYILTKNFDEEQIWGQISLL
SKKISKKLDEEDQLVKAKALEKDNEDDEDISVDSSHGSQDNESDLEKHSEDDEEEIADEA
PQKIQEDQEDQEAREQDFFNPDEMVRFADEGDMEKDDPGFSASDEESESQSEDEEVKEKY
QDFYKDPEEHSSEEEQEKMFSLVDEDEMERLEEKLVNQKPWQMKGEINSKSRPKNSLLDE
ELDFEIARNPAPQTQTKEVTDEIENIIKQRILDMLYDDVKPKRPVEKVETKTAAEDFMDY
EKSKKSLAELYEEDFKKQVLHIPVNTETERAKKEVTVIFRKLCYNLDLMSSLHPVAKPVL
KDLEIKSASVPALVLEEQLPFGKSSEGLKTPNEVFDPKNAVLKSKEEHTKSDKNAIRKRH
KSTLRTRRKERVMKIMNKMAQDPKGQKFEYRRLVKEEKARKELLERKKQPKTKFTRSSEF
FKNFQELSQEMKTEKKKKIEKSEPKPSKKIKL


>SteCoe_28836(CDS)
ATGGAAAGCTTTAAGGAGCTAATAGGTACTATCCCTGATGCTACATACCTGCTAACTCCA
AGCACTTCCTTAGCTGAAAGATCTTTAAAAACCCTGGAAGTCCTTACTGAAAGTTTGCAA
GAATACATTCTGACTAAAAACTTTGACGAAGAACAAATCTGGGGTCAAATTTCTTTACTT
TCCAAAAAAATCTCAAAGAAACTTGATGAAGAAGACCAGCTTGTAAAAGCAAAAGCATTA
GAAAAAGACAATGAAGATGATGAAGACATATCAGTAGACTCTTCGCATGGATCTCAAGAT
AATGAGTCTGACTTAGAAAAACATTCAGAAGATGATGAAGAAGAAATAGCTGATGAAGCA
CCACAAAAAATTCAAGAAGACCAAGAAGATCAAGAAGCAAGAGAACAAGACTTTTTTAAC
CCTGATGAAATGGTCAGATTTGCTGATGAAGGGGATATGGAAAAAGATGACCCTGGATTT
TCAGCTTCTGATGAAGAGTCTGAAAGTCAGTCAGAAGATGAAGAAGTCAAAGAAAAATAT
CAAGACTTTTATAAGGATCCAGAAGAACATTCTAGTGAAGAAGAACAAGAAAAAATGTTC
AGTCTTGTGGATGAAGATGAAATGGAAAGACTTGAGGAAAAACTTGTAAACCAAAAGCCT
TGGCAAATGAAGGGAGAAATAAACTCGAAAAGTAGACCTAAGAACTCTTTGCTTGATGAA
GAACTAGACTTTGAAATCGCTAGGAACCCTGCACCACAGACACAAACAAAAGAAGTTACA
GATGAAATTGAAAATATTATCAAACAAAGAATTCTTGATATGCTTTATGATGATGTTAAA
CCTAAAAGGCCTGTGGAGAAAGTAGAAACTAAAACTGCTGCTGAGGATTTTATGGATTAT
GAAAAGTCTAAGAAAAGTTTAGCTGAATTGTATGAAGAAGATTTCAAAAAACAAGTTTTG
CATATTCCTGTGAACACTGAAACTGAAAGAGCTAAAAAGGAAGTGACTGTAATTTTTAGA
AAATTGTGCTATAATTTGGATTTAATGAGTAGTCTTCATCCAGTAGCAAAACCCGTACTC
AAAGATCTAGAAATTAAAAGTGCTAGTGTCCCAGCTTTAGTTCTTGAAGAGCAGCTTCCA
TTTGGCAAAAGTTCTGAAGGACTCAAAACGCCAAATGAAGTATTTGATCCAAAAAATGCA
GTTCTAAAATCCAAAGAAGAGCATACAAAAAGTGACAAAAACGCAATTCGTAAAAGACAT
AAGTCCACTCTGCGCACTCGACGAAAAGAGAGAGTTATGAAAATAATGAACAAAATGGCC
CAAGATCCAAAAGGTCAGAAATTTGAATACCGGCGTCTTGTCAAAGAAGAAAAAGCACGA
AAAGAGCTACTTGAACGTAAAAAACAGCCAAAAACTAAATTCACAAGGTCTTCAGAATTC
TTCAAAAACTTCCAAGAGCTCAGCCAAGAAATGAAAACTGAAAAGAAAAAGAAAATTGAA
AAATCAGAGCCAAAACCAAGCAAAAAAATAAAACTTTAA