Identifiers and Description

Gene Model Identifier

SteCoe_28861

Standard Name

None

Aliases

None

Description

Cyclin

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of cyclin-dependent protein serine/threonine kinase activity (IEA) | GO:0000079

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007324600.00000000000009357622968840175Cyclin, N-terminal domain cont
aining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28861(Protein)
MKCSEETYILALIYLDRVTAKKTDLVLNIYCIHRLFLSALVVAAKFFEDRYYKNSYYSKV
GGIANPELNTLEMEFLVYIDFRLYVSNEEYENYYNTLIEYFGKKQQP


>SteCoe_28861(CDS)
ATGAAATGTTCAGAAGAAACTTATATTCTGGCTTTAATCTATTTGGACAGGGTTACAGCT
AAGAAAACTGACCTCGTTTTGAACATTTATTGCATTCATAGGCTTTTCCTTTCAGCTTTA
GTTGTTGCGGCTAAGTTCTTTGAGGACCGGTATTACAAAAACTCGTATTATAGCAAAGTT
GGGGGAATTGCAAACCCTGAACTTAATACCCTTGAAATGGAGTTCCTTGTTTACATTGAT
TTTAGGCTTTATGTTTCGAATGAAGAGTATGAAAACTATTACAACACATTAATCGAATAT
TTCGGTAAGAAGCAACAGCCTTAA