Identifiers and Description

Gene Model Identifier

SteCoe_28945

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010979602.9374821117108028e-30Rab II family protein; small m
onomeric GTPase that regulates
membrane fusion and fission e
vents
WormBaseWBGene000042762.1705220113036395e-29
Oxytricha TrifallaxContig13582.0.g551.185064864233981e-27Ras family

Saccharomyces CerevisiaeYER031C1.2995814250075031e-24Rab family GTPase; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi; YPT31 ha
s a paralog, YPT32, that arose
from the whole genome duplica
tion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28945(Protein)
MVDRDYDFMFKIIIIGESGTGKSCILHYLLENRFKKNPNHTVGVEFGCKHIEIFGKRIKL
QIWDTAGQERFRSVTKSYYRGAAAAILVYDITNTETFAKLNTWINDAKALSRQDICMIIL
GNKSDLGSARTVSFLQAANFCQENQIQFLETSAVTGENIEIAFQTIAKIVLERLKDGQLQ
NFKGIQPGRDSTRDRSCNC


>SteCoe_28945(CDS)
ATGGTTGATCGAGACTATGATTTTATGTTCAAAATAATAATCATAGGAGAAAGTGGCACA
GGCAAATCCTGCATTCTTCATTATCTGCTAGAAAATCGCTTTAAAAAGAATCCCAATCAC
ACTGTTGGTGTAGAATTTGGATGTAAACACATAGAAATTTTCGGCAAAAGAATCAAACTC
CAGATCTGGGACACAGCCGGACAAGAACGGTTTAGGAGTGTCACAAAAAGTTATTACCGA
GGAGCAGCTGCTGCTATATTAGTCTACGATATCACAAATACAGAAACTTTTGCCAAGCTA
AATACATGGATTAATGATGCAAAAGCATTATCAAGACAAGACATTTGTATGATTATTTTG
GGTAATAAATCAGATCTTGGGTCAGCCAGAACAGTGAGTTTTTTACAGGCAGCGAATTTT
TGCCAAGAAAACCAGATCCAGTTTCTTGAGACTAGTGCTGTAACAGGGGAAAATATTGAA
ATAGCTTTTCAAACCATAGCTAAAATTGTGTTGGAAAGACTTAAAGACGGTCAGCTGCAA
AATTTTAAAGGAATACAGCCAGGAAGAGACTCCACACGCGATCGTTCTTGCAATTGCTGA