Identifiers and Description

Gene Model Identifier

SteCoe_28957

Standard Name

None

Aliases

None

Description

E2F_TDP domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010991500.0000000000002543665647376923Transcription factor E2F/dimer
isation partner (TDP)"
Oxytricha TrifallaxContig20893.0.g820.00000000003775134544279098E2F/DP family winged-helix DNA
-binding domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_28957(Protein)
MNSSQKKRSEESSEVSSPSSTPKKGVGTPGGRQEHSLGVLTQKFLDLLLNSDEKTIDLNQ
AVHILGVPKRRIYDITNVLEGVGLVEKKLKNRIQWVGDSLENSEILDLFQSQEANLDFWT
REMERKIDDLLETNKDLAYLTLEDLQNLHGTQKTMIAIRSPPGTSVEVVSASPQEQEVNL
HSETGEILVHFFSQ


>SteCoe_28957(CDS)
ATGAACTCGAGCCAGAAAAAGCGCTCTGAGGAATCCTCTGAAGTTAGTTCGCCGAGCAGT
ACTCCTAAGAAAGGGGTTGGGACACCAGGAGGCAGACAGGAACACTCTTTAGGTGTTTTA
ACACAGAAGTTTTTAGATCTTCTCTTGAATTCTGATGAAAAAACTATCGACCTGAATCAG
GCTGTGCATATCCTAGGAGTGCCTAAAAGAAGAATATACGACATAACAAATGTCTTAGAA
GGAGTTGGGCTAGTTGAAAAAAAATTAAAAAATCGAATCCAATGGGTTGGCGACTCTCTA
GAAAATTCAGAAATCCTCGACCTTTTCCAAAGTCAAGAAGCAAATTTAGACTTCTGGACT
AGAGAAATGGAAAGAAAAATCGATGACTTGCTGGAGACTAACAAGGACTTGGCTTATTTG
ACTTTAGAAGACCTCCAAAACCTTCATGGAACTCAGAAAACTATGATCGCGATTAGATCT
CCACCAGGAACATCAGTTGAGGTTGTCTCAGCATCACCACAGGAACAAGAAGTTAATCTA
CACTCAGAAACAGGTGAAATTCTTGTTCATTTCTTTTCTCAGTAA