Identifiers and Description

Gene Model Identifier

SteCoe_29073

Standard Name

None

Aliases

None

Description

IF-2B domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18132.0.g711.603810890548638e-28Initiation factor 2 subunit fa
mily

Tetrahymena ThermophilaTTHERM_001939604.359610000063081e-28Initiation factor 2 subunit fa
mily protein
Saccharomyces CerevisiaeYLR291C1.9287498479639178e-22Beta subunit of the translatio
n initiation factor eIF2B; the
guanine-nucleotide exchange f
actor for eIF2; activity subse
quently regulated by phosphory
lated eIF2; first identified a
s a negative regulator of GCN4
expression

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29073(Protein)
MDHLTLNFENFLRSLKRGDNTGTYELCRRTCKFLLSLIKQFKLTEVRDVPNLISTISLFG
QLSTRILPLEISVVNIVRRVLHIIREEACHRNIDLSSEAQRITTLTGFFRETEAFTLTVD
YKDFRESIKNEVKNLYEEIETHEKSISDQASTHIFSNEIILTYGYSSTVLQFLCSAKSAG
RNFEVLVGESAPLLSGHQMCKDLASKNIATTLITDSAVYALMSRVNKVIIGTRALMANGG
LLTEAGKYGVCLAAQAHCVPVLVTCGLFKLSPLYPFDQDTFNEFLSPNTIADKPESQEIQ
YINYSVPAFDYIPPELVSLYITDVGGKMCSYLYRLLSEYYSNEDYNLYS


>SteCoe_29073(CDS)
ATGGACCACTTGACTCTTAATTTCGAAAACTTTCTAAGATCTCTCAAACGTGGAGACAAT
ACCGGAACATATGAACTCTGCCGTAGAACCTGTAAATTTCTCCTAAGCCTAATCAAGCAA
TTTAAACTTACCGAAGTTCGAGACGTCCCAAATCTTATATCAACAATCTCATTATTTGGT
CAACTTTCAACTCGTATTCTTCCTCTAGAAATCTCAGTTGTCAACATAGTCCGAAGAGTC
CTTCATATAATCCGTGAAGAAGCTTGTCACCGTAATATCGACTTATCAAGTGAAGCCCAG
CGTATCACAACTTTAACTGGGTTCTTTCGTGAAACTGAAGCTTTTACCTTAACAGTTGAT
TATAAAGACTTCCGCGAGTCTATTAAAAACGAAGTCAAAAATCTATATGAAGAAATCGAA
ACTCATGAAAAAAGCATATCAGACCAAGCATCAACACATATATTTTCTAATGAAATAATC
CTCACATATGGTTACTCAAGTACTGTATTACAGTTTTTATGTTCAGCAAAAAGTGCTGGG
AGGAACTTTGAGGTTTTAGTCGGAGAAAGTGCTCCATTATTGTCAGGGCATCAAATGTGT
AAAGATTTAGCATCTAAGAACATAGCGACAACTTTGATAACAGATTCAGCTGTTTATGCA
TTAATGAGTAGGGTTAATAAGGTTATTATTGGTACTAGAGCATTGATGGCTAATGGGGGT
TTATTAACTGAAGCAGGAAAATATGGAGTATGTTTAGCTGCTCAAGCCCATTGTGTCCCA
GTATTAGTAACTTGTGGGCTTTTTAAACTATCCCCTTTATATCCTTTTGATCAAGATACA
TTTAATGAATTCTTATCTCCTAATACTATAGCAGATAAGCCAGAATCTCAAGAAATTCAA
TATATAAATTATAGTGTTCCAGCTTTTGATTATATTCCCCCTGAACTTGTTTCTTTATAT
ATCACTGATGTCGGGGGGAAAATGTGTTCGTATTTGTATAGACTTCTCTCTGAATACTAT
AGTAATGAAGATTATAACCTATACAGCTAA