Identifiers and Description

Gene Model Identifier

SteCoe_29090

Standard Name

None

Aliases

None

Description

FBPase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000585904.7111658015535965e-58fructose-1,6-bisphosphatase fa
mily protein
WormBaseWBGene000014044.1863939993042314e-51
Saccharomyces CerevisiaeYLR377C1.2479464629129513e-47Fructose-1,6-bisphosphatase; k
ey regulatory enzyme in the gl
uconeogenesis pathway, require
d for glucose metabolism; unde
rgoes either proteasome-mediat
ed or autophagy-mediated degra
dation depending on growth con
ditions; glucose starvation re
sults in redistribution to the
periplasm; interacts with Vid
30p
Oxytricha TrifallaxContig8398.0.g931.1548224173015786e-17Fructose-1-6-bisphosphatase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29090(Protein)
MDSQRAKFLSIESNPITLARAIMSDQRRHPEAKGDLTMILSSLMLACKFVSNAVRKAGIA
SLIGISGSSNVQGEQQKPLDILANDIFINSLKYCNKIAALASEEETGIYIIDNPDEAKYV
IAFDPLDGSSNIDVNVSIGSIFAIWKRPDYSKPVVLEDFLRTGAEVEVSGYCIYGSSTQL
VIATKEGKVDCFTLDNSIGDFILTHPNLRIPKKGNIYSVNEGNSHFWDKSMKEYVNLVKT
PQDDNTYSLRYVGSMVSDVHRTLLYGGIFLYPADKKSPNGKLRVLYEVFPMSFIVEAAGG
KATDGRRRLLDIKAHDIHQRSPCILGSPDDVDTIVAIYAKNDEEEAKNTN


>SteCoe_29090(CDS)
ATGGATTCACAAAGAGCCAAGTTCCTGTCAATAGAGTCGAACCCTATCACCCTTGCTAGA
GCCATTATGTCTGACCAGCGCCGTCATCCTGAAGCCAAAGGTGACTTGACTATGATTCTG
AGTTCATTAATGCTCGCATGCAAATTTGTCAGTAATGCTGTAAGGAAAGCTGGGATCGCT
TCTTTGATCGGAATTTCTGGATCGTCTAATGTACAAGGGGAACAACAAAAACCTTTGGAC
ATCTTAGCAAATGACATATTTATCAATTCATTGAAGTATTGTAACAAAATCGCAGCTTTA
GCTTCAGAGGAAGAGACTGGTATTTATATCATTGATAACCCTGATGAAGCTAAATATGTT
ATTGCTTTTGATCCTCTAGATGGCTCTTCTAACATTGATGTTAATGTTTCTATCGGATCC
ATTTTCGCTATTTGGAAACGCCCAGACTACTCAAAGCCAGTAGTCCTAGAAGACTTTTTG
CGTACAGGTGCTGAGGTTGAAGTATCAGGTTATTGCATCTATGGGAGTTCAACCCAGCTT
GTTATTGCAACAAAAGAAGGTAAAGTTGACTGTTTCACACTAGATAATTCAATTGGAGAC
TTCATATTAACACATCCTAACCTAAGAATACCAAAAAAAGGGAACATTTACTCAGTAAAC
GAAGGGAACTCACATTTCTGGGACAAAAGTATGAAAGAATACGTAAATCTAGTCAAAACT
CCACAAGATGATAACACTTACTCTTTAAGATATGTAGGGTCAATGGTCTCTGATGTCCAT
AGAACTCTACTTTATGGAGGTATTTTCTTATACCCTGCAGATAAAAAGTCCCCTAATGGT
AAACTTAGAGTCCTTTATGAAGTTTTCCCAATGAGCTTTATTGTTGAAGCAGCTGGTGGG
AAAGCTACAGATGGAAGAAGGAGACTTTTAGATATCAAAGCTCATGATATACATCAAAGA
TCACCATGCATCCTTGGAAGTCCTGATGATGTTGACACAATTGTTGCTATTTATGCAAAA
AATGATGAAGAGGAAGCTAAAAATACCAATTAA