Identifiers and Description

Gene Model Identifier

SteCoe_29113

Standard Name

None

Aliases

None

Description

Avl9 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22456.0.g761.0530617357553812e-20Transport protein Avl9

Tetrahymena ThermophilaTTHERM_003738007.781132241133797e-20protein with predicted MORN do
mains localized at the C-termi
nus of the protein
Saccharomyces CerevisiaeYLR114C0.00000000000003442477108469977Conserved protein involved in
exocytic transport from the Go
lgi; mutation is synthetically
lethal with apl2 vps1 double
mutation; member of a protein
superfamily with orthologs in
diverse organisms; relocalizes
from bud neck to cytoplasm up
on DNA replication stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29113(Protein)
MYGITEEYPLHSIHVIGFHHKQGSILEYTYPEGKNCELISYLALPDCVHNETAETFFFTL
NLQGCIKHCVSCFRQIPNDHVTVEMNRNYVQKAVVIVSNIPFYGLISSYMQGPTKAYFDQ
GDFSNTNILSEAFESINRSFTQVSLSELYLGFSTRMLLHLFKEKVFMIFKLILLQGRIIV
FSKKPSQVSSIIYALLSLYPGQLCFDSLDYFPDYKAYLEMLGLPLKIFNDNYVLHSYISI
FQLSEMEKSAYLVGCTNLMITQHPRSKPHAVINIDTGKIKFTLPGKMMDCVKLNSAESKF
IKDRCNGVESSWNSRETWEVSENEIWNRSHYNIINDFHNFFKDKLCSLAFARLRMQGQKI
DTLMKRDKMSSKKFKYYNLDPEEKKVSKYKKFTKGLRSSFIAKWTNTENFKQWLQNHNPI
SAHLSEHCGKIYSGQVISNEIFYENGDIYKGGLCGGKRNGIGILTNKDWSYEGEWKNNVK
SGKGTLTKNDGSYIYEGEWDGDTQNGEGSEIKGREKYFGSFVNGKYHGNGIYIDNDLNQF
NGEWVHGLRMDASHDLK


>SteCoe_29113(CDS)
ATGTATGGAATCACTGAAGAATATCCTCTTCATAGCATACATGTTATAGGGTTTCATCAT
AAACAAGGAAGCATATTAGAATATACTTACCCAGAAGGAAAAAACTGTGAGCTTATTTCT
TATCTAGCACTTCCAGACTGTGTCCACAATGAAACAGCGGAAACATTTTTTTTTACACTG
AATCTTCAAGGTTGCATCAAACATTGTGTTTCATGCTTTCGACAAATCCCAAATGACCAT
GTGACAGTAGAAATGAACAGAAATTACGTTCAAAAAGCTGTGGTAATTGTATCTAATATA
CCTTTTTATGGTCTAATCTCTTCATATATGCAAGGTCCAACTAAGGCTTACTTTGATCAA
GGAGATTTTTCTAATACTAATATACTATCTGAGGCTTTTGAATCTATAAATAGAAGCTTT
ACACAAGTTTCTTTATCAGAACTTTATTTAGGTTTCTCAACACGAATGCTTTTACACTTA
TTTAAAGAAAAAGTTTTCATGATTTTCAAATTGATTCTATTACAAGGAAGAATTATTGTG
TTTTCTAAAAAACCAAGTCAGGTAAGTTCAATAATATATGCATTATTATCATTATATCCT
GGGCAGCTTTGTTTTGACAGTTTGGATTATTTTCCTGATTACAAAGCATATTTAGAAATG
CTTGGCCTTCCACTTAAGATATTTAATGATAACTATGTATTACATAGTTATATTTCTATA
TTTCAATTGTCAGAAATGGAAAAAAGTGCTTATCTTGTTGGTTGCACAAATTTAATGATT
ACTCAGCATCCAAGATCTAAGCCACATGCTGTAATTAATATTGACACAGGTAAAATTAAG
TTTACCTTGCCTGGAAAAATGATGGACTGTGTAAAATTAAATTCAGCAGAAAGTAAGTTT
ATTAAAGATAGATGTAATGGAGTTGAAAGCAGCTGGAATTCAAGAGAAACATGGGAAGTT
AGTGAAAATGAAATATGGAATAGAAGTCATTATAATATAATAAATGATTTCCACAATTTT
TTCAAAGATAAACTGTGTAGTCTTGCGTTTGCCAGACTGAGGATGCAAGGGCAGAAAATT
GATACCTTGATGAAAAGGGATAAAATGTCATCTAAAAAGTTTAAGTACTACAACTTAGAT
CCTGAAGAAAAAAAAGTTTCAAAATATAAAAAGTTTACAAAAGGACTTAGAAGTTCATTT
ATAGCAAAGTGGACAAATACTGAGAATTTTAAACAATGGTTACAAAATCATAATCCAATT
TCAGCTCATTTATCAGAACATTGTGGTAAAATTTATTCAGGACAAGTTATTTCTAATGAG
ATATTTTATGAGAATGGGGATATATATAAAGGAGGTCTTTGTGGAGGGAAAAGAAATGGA
ATAGGGATTTTAACTAATAAAGACTGGAGTTATGAAGGGGAATGGAAAAACAATGTTAAA
AGTGGTAAAGGAACTTTGACAAAAAATGATGGAAGCTATATATATGAAGGAGAGTGGGAT
GGAGATACTCAGAATGGAGAAGGTTCTGAAATTAAAGGACGAGAAAAGTATTTTGGATCT
TTTGTTAATGGGAAGTATCATGGAAACGGAATTTACATTGATAATGATTTGAACCAGTTT
AATGGAGAATGGGTACATGGTTTAAGGATGGACGCAAGTCATGATTTAAAGTAA