Identifiers and Description

Gene Model Identifier

SteCoe_29255

Standard Name

None

Aliases

None

Description

JmjN domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004676908.194012623990515e-40jmjC domain containing protein
Oxytricha TrifallaxContig9894.0.g511.8048513878454153e-35JmjC domain, hydroxylase

WormBaseWBGene000129825.380186160021138e-32
Saccharomyces CerevisiaeYER169W1.185064864233981e-27JmjC domain-containing histone
demethylase; specifically dem
ethylates H3K36 tri- and dimet
hyl modification states; assoc
iates with actively transcribe
d (RNAP II) regions in vivo an
d specifically targets H3K36 i
n its trimethylation state as
its substrate; transcriptional
repressor of PHR1; Rph1p phos
phorylation during DNA damage
is under control of the MEC1-R
AD53 pathway; target of stess-
induced hormesis; RPH1 has a p
aralog, GIS1, that arose from
the whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29255(Protein)
MNNIECPVFYPTTAEFQNFEAYMVKIESQSKGYGMAKVIPPAEWKARRKGYKDINPKITH
PVRQVVSGLAGIYQVVLISERQMEYTAYKKYAKKRELNSELSVEEIERKFWKNIRYDSAV
YGADSDTISLFDRNTEWNLSELSNLLEDGLKPLKLNGINTPFLYLGSWKSMFCWHKEDLD
LYSINFLHFGKPKIWYCIPDSENEKFERLCQFHFREEYAQCKEFLRHKMTQISPSVLKGA
GIKYHRAVHNPGEFMVIFSKCYHMGFNAGFNCAEAVNFATENWIETGERVRRCLCDPDCV
RIDMEEFKQRLKDNRNEGNPHKRAKHA


>SteCoe_29255(CDS)
ATGAACAATATCGAATGCCCTGTTTTTTATCCAACCACTGCAGAATTTCAAAACTTCGAA
GCGTACATGGTAAAAATCGAGTCCCAGTCTAAAGGGTACGGTATGGCCAAAGTCATCCCT
CCAGCAGAGTGGAAAGCTCGAAGAAAAGGCTATAAAGACATAAATCCCAAAATAACCCAT
CCTGTCCGTCAAGTTGTATCAGGTCTCGCAGGAATCTATCAAGTAGTCCTAATCTCTGAG
CGTCAAATGGAGTACACCGCATATAAAAAATACGCAAAAAAACGAGAACTAAACTCTGAA
CTATCAGTAGAAGAAATTGAAAGAAAGTTCTGGAAAAACATACGTTATGACTCTGCAGTC
TATGGTGCTGATAGTGACACAATAAGTCTTTTTGACAGAAACACTGAATGGAATTTATCA
GAGCTTTCGAATTTGTTAGAAGATGGTCTCAAACCGTTAAAACTAAATGGAATCAATACC
CCATTCTTATATCTAGGTTCTTGGAAAAGCATGTTTTGTTGGCATAAAGAAGATCTTGAC
CTTTATTCAATAAACTTTCTTCATTTTGGTAAGCCTAAAATTTGGTATTGCATACCTGAT
AGTGAAAATGAAAAATTTGAAAGATTATGCCAGTTCCATTTTAGAGAAGAATATGCACAA
TGCAAAGAGTTTTTAAGGCATAAAATGACACAGATTTCTCCTAGTGTACTTAAGGGAGCA
GGAATTAAATACCATAGGGCTGTACATAACCCTGGAGAATTTATGGTGATTTTCTCGAAA
TGCTATCATATGGGGTTTAATGCAGGATTTAATTGCGCTGAAGCTGTAAATTTTGCTACG
GAAAACTGGATTGAAACTGGGGAAAGGGTTAGGAGGTGCCTTTGCGACCCGGATTGTGTT
AGGATTGATATGGAGGAATTTAAACAAAGATTAAAAGATAACAGAAATGAAGGGAATCCT
CATAAAAGAGCCAAACATGCTTAG