Identifiers and Description

Gene Model Identifier

SteCoe_29330

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18999.0.g660DEAD/DEAH box helicase

WormBaseWBGene000018400
Saccharomyces CerevisiaeYDL084W1.3485799642996046e-77Component of the TREX complex
required for nuclear mRNA expo
rt; member of the DEAD-box RNA
helicase superfamily and is i
nvolved in early and late step
s of spliceosome assembly; hom
olog of the human splicing fac
tor hUAP56; relocalizes from n
ucleus to cytoplasm upon DNA r
eplication stress
Tetrahymena ThermophilaTTHERM_004693804.7111658015535965e-58DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29330(Protein)
MKKRDEELPDYSEDNEVEEQKGPKTRVKKGGFSGLHSAGFSEFLLKEEIMNSIHECGFEH
PSEVQQEALPQAIMGTDIVCQAKSGMGKTAVFVLSVLHQLETPPKPISVLVLAHTRELAF
QIKREFDRFSKRLEGVKTEVFYGGVQISQQITVLKTPPTIIVGTPGRILALARKGSLKLD
GIKHFVMDECDKMLDQLDMRSDVQHIFRLTPHTKQVMMFSATMNKEIRNVFRKFVQNQVE
IFIDDESKLTLHGLQQYYVKLAETEKNKRLIDLLDALQFNQVVIFVKSVSRAIELNKILV
ECRFPSTAIHAGLNQEERINRFKSFKDFNKRVLVSTDLFGRGIDIERVNIVINYDMPRKE
ERAEKENSGSNTYLHRVGRAGRFGTKGLAISFISSDEDTQVLNEIQERFDIAVNELPAMI
NISTYMN


>SteCoe_29330(CDS)
ATGAAGAAGCGAGACGAAGAATTGCCCGACTACTCTGAAGACAATGAAGTCGAAGAACAA
AAAGGACCAAAAACCAGAGTCAAGAAAGGTGGGTTCTCAGGACTCCATTCAGCAGGTTTT
TCAGAGTTCCTTCTCAAGGAAGAGATAATGAACTCTATCCACGAATGCGGCTTCGAGCAC
CCTAGTGAAGTGCAGCAAGAAGCCCTTCCACAAGCCATTATGGGCACCGATATCGTTTGC
CAGGCTAAAAGTGGTATGGGCAAGACCGCTGTGTTTGTTTTATCAGTACTTCACCAGCTC
GAAACCCCTCCAAAACCTATCTCAGTCCTAGTCCTTGCGCATACTCGTGAGCTTGCTTTT
CAAATCAAACGTGAGTTCGACAGGTTCTCAAAAAGACTTGAAGGTGTCAAAACTGAAGTG
TTCTATGGAGGTGTGCAAATAAGCCAGCAAATCACTGTGCTTAAAACCCCACCGACCATT
ATAGTGGGGACTCCAGGACGTATTCTAGCTTTGGCGCGAAAAGGGTCATTGAAACTTGAT
GGTATCAAACATTTTGTTATGGACGAATGCGACAAAATGCTCGATCAACTCGATATGAGA
AGTGATGTTCAGCATATTTTCAGACTTACTCCTCATACAAAGCAAGTTATGATGTTTAGT
GCAACAATGAATAAAGAAATCCGTAATGTCTTCAGGAAATTTGTCCAAAATCAAGTGGAG
ATTTTTATTGACGATGAGTCAAAACTCACACTTCATGGACTTCAACAATATTATGTGAAA
CTTGCTGAAACAGAAAAAAATAAAAGGCTTATTGATTTACTAGATGCCTTACAATTTAAT
CAAGTTGTGATTTTTGTCAAGAGCGTTAGCCGAGCTATAGAATTGAATAAAATTTTAGTA
GAATGCCGGTTTCCGAGTACGGCTATTCATGCTGGATTAAATCAAGAAGAAAGAATTAAC
AGATTCAAGAGCTTTAAAGATTTCAATAAACGTGTGCTTGTGTCGACTGATTTGTTTGGA
AGGGGGATTGATATTGAGAGAGTGAATATTGTGATCAATTATGACATGCCACGAAAAGAG
GAAAGAGCTGAAAAAGAAAACTCCGGATCAAATACTTATTTGCATAGAGTTGGCCGTGCT
GGAAGATTTGGAACGAAAGGGTTGGCGATTTCTTTTATATCTTCAGATGAGGACACCCAG
GTGCTAAATGAGATTCAAGAGCGCTTTGATATAGCGGTTAATGAGTTGCCCGCGATGATC
AATATTTCTACCTACATGAACTAA