Identifiers and Description

Gene Model Identifier

SteCoe_29331

Standard Name

None

Aliases

None

Description

zf-NF-X1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16975.0.1.g311.580420060273613e-61NF-X1 type zinc finger

Tetrahymena ThermophilaTTHERM_003174001.733141042341547e-58Fusion of two proteins involve
d in mRNA export, NF-X1 and GA
NP; SAC3/GANP family protein
WormBaseWBGene000070485.0345753587649823e-45
Saccharomyces CerevisiaeYNL023C3.6251409191435593e-34Protein that binds to Fpr1p; c
onfers rapamycin resistance by
competing with rapamycin for
Fpr1p binding; accumulates in
the nucleus upon treatment of
cells with rapamycin; has simi
larity to D. melanogaster shut
tle craft and human NFX1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29331(Protein)
MDSKPYRFKKKKKPPGFKQPRTEFQGPQGPKSAKNPALARWQKPEGSEQYSELLTKLIGR
ELECMVCMYQIGWRGKIWNCEQCRIPEHLTCIKKWKESSGNRWNCPACNYEYTTEPKYTC
FCGKTEEPVQHPMYPPHSCGEVCGRSRGNDCPHLCPQQCHPGACPSCTSMAAPQTCYCTK
KTYQPMCKDKHIGQSCDEICGKKLNCDSHYCQNKCHEGPCQKCCVVITQDCYCGKESVTV
DCGMPIVCQNKCNKTLSCGKHFCDKNCHAGSCGVCKLSPNLVSRCPCGKNSLDMILLNPR
TSCCDPIPSCYGVCDKILSCGHKCKVACHNGLCPPCKATQKITCRCTRTIQDVKCQDLTK
QILCNKLCTTKKSCKRHKCNQQCCSGLDDPYSDEHRCLETCGKILNCSIHTCLSHCHIGN
CEPCKVITRVRIFCPCGRSYKDPPIRCGTKDMEIGCTFKCAKILSCGHNCLSTCHSGECP
SCSQLIEKPCRCGKMFLPIGCGILTVSCGKICGKVLKCEHNCVEKCHNEECEKYIKQHLC
KKKKDRCSHTCLANCHYPNPCPQEPCQVHISVFCPCGSQSIIAACGEGKVLECDDGCLKI
KRDKALGTGEKELYSEELVEFAKGNMEFINKVEGKLATIIAKKDKVTFLPPMKEKQRWLC
HELATHHYKLDTQSLDKEPYRSVYVYLTDTARVPQPVLSEFVSLVNQGIETEFEKKEIMA
SLLFYQLSSSVTTDDLNDVLQKFSGDFYVKWENDHSAYAHFFSIHKCSEAKKILERTPGQ
YSVVKMIMNTPAEDTTGFKKRFRNMKKAKEVLSFDDDEKEEKNIVEIKTQEKTEFVKKVE
KIFEEKKGSIFQELNDED


>SteCoe_29331(CDS)
ATGGATTCTAAGCCATACCGATTTAAGAAAAAGAAAAAACCACCAGGATTTAAGCAACCA
AGAACAGAGTTCCAAGGACCCCAAGGGCCAAAAAGTGCTAAAAACCCCGCTTTAGCTCGT
TGGCAGAAACCTGAAGGGTCAGAACAATACAGTGAGTTGCTAACAAAGCTCATAGGTCGA
GAGCTTGAATGTATGGTGTGCATGTATCAAATCGGGTGGCGAGGGAAAATCTGGAACTGC
GAACAATGCAGAATCCCTGAGCACCTCACTTGTATCAAAAAATGGAAAGAAAGCTCTGGT
AATCGTTGGAATTGCCCAGCTTGTAACTATGAATATACAACAGAACCTAAATATACATGC
TTTTGTGGTAAAACTGAAGAACCAGTTCAACATCCTATGTATCCACCTCATTCATGTGGT
GAAGTATGTGGCCGATCAAGAGGAAATGATTGTCCTCATTTATGTCCACAACAATGTCAT
CCTGGAGCTTGTCCATCATGTACTTCTATGGCTGCACCTCAAACTTGTTATTGTACGAAA
AAAACATATCAACCTATGTGTAAAGATAAACATATAGGGCAATCGTGTGATGAAATATGT
GGGAAAAAATTAAATTGTGATAGTCATTATTGTCAGAATAAATGCCATGAAGGACCTTGT
CAGAAATGTTGTGTTGTTATCACACAAGATTGTTATTGTGGGAAAGAATCTGTTACTGTA
GATTGTGGAATGCCTATAGTATGTCAGAATAAATGTAATAAAACATTGAGTTGTGGTAAG
CATTTTTGTGATAAAAACTGCCATGCTGGGAGTTGTGGGGTATGCAAACTTAGTCCAAAT
TTAGTTAGTCGTTGTCCATGTGGTAAGAATTCTTTGGATATGATATTACTTAATCCTAGA
ACATCATGTTGCGACCCTATACCTAGTTGTTATGGTGTTTGTGATAAAATATTATCATGT
GGGCATAAATGTAAAGTTGCATGTCACAATGGATTATGCCCACCTTGTAAAGCTACACAA
AAAATCACATGTAGATGCACAAGGACTATACAAGATGTAAAATGCCAAGATTTAACCAAA
CAAATTTTATGTAATAAACTCTGCACAACTAAAAAATCATGTAAAAGACATAAATGTAAT
CAACAATGTTGTTCAGGATTAGATGATCCATATAGTGATGAACATAGATGTCTTGAAACA
TGTGGGAAAATACTTAATTGTTCTATTCACACTTGTCTTAGCCATTGCCATATAGGAAAT
TGTGAACCATGTAAAGTTATAACAAGGGTAAGGATTTTTTGTCCATGTGGAAGAAGTTAT
AAAGATCCACCTATAAGATGTGGGACTAAAGATATGGAAATTGGATGTACATTTAAATGT
GCTAAAATTTTATCATGTGGGCATAATTGTCTTAGTACATGTCATTCAGGAGAATGTCCA
TCATGTTCACAACTTATAGAAAAACCATGTAGATGTGGGAAAATGTTCTTGCCTATAGGA
TGTGGGATTTTAACTGTATCTTGTGGGAAGATTTGTGGGAAAGTTCTGAAATGTGAGCAT
AATTGTGTTGAAAAATGTCATAACGAAGAATGTGAAAAGTATATAAAACAGCATCTTTGT
AAGAAAAAAAAAGATAGATGTAGTCATACGTGTTTGGCTAATTGCCATTATCCAAATCCT
TGTCCTCAAGAACCTTGTCAAGTTCATATTAGTGTTTTTTGCCCATGTGGAAGTCAGAGT
ATTATTGCAGCTTGTGGTGAAGGTAAAGTTCTTGAATGTGATGATGGGTGTTTGAAAATT
AAAAGGGATAAAGCTTTGGGAACTGGAGAAAAAGAACTTTATTCTGAAGAACTTGTTGAG
TTTGCTAAAGGGAATATGGAGTTTATAAATAAAGTTGAAGGAAAACTTGCCACGATTATA
GCAAAAAAAGATAAAGTAACTTTTTTACCCCCGATGAAAGAGAAACAACGCTGGTTATGT
CATGAACTTGCAACACATCATTATAAACTTGATACTCAAAGTTTAGATAAAGAGCCTTAT
AGAAGTGTGTATGTATATTTAACTGATACAGCAAGGGTTCCTCAGCCTGTGCTTTCAGAG
TTTGTGTCACTAGTTAATCAAGGAATTGAGACTGAGTTTGAGAAAAAAGAAATCATGGCA
TCGCTATTGTTTTATCAGTTGTCATCATCTGTTACAACTGATGATCTTAATGATGTTTTA
CAAAAATTCTCAGGGGATTTTTATGTAAAATGGGAAAATGACCATAGCGCTTATGCTCAT
TTTTTTAGTATTCACAAATGCTCTGAGGCTAAAAAGATCCTAGAAAGAACCCCAGGACAA
TATTCTGTAGTTAAAATGATTATGAATACCCCAGCTGAAGATACAACAGGGTTTAAAAAA
CGCTTTAGGAATATGAAAAAAGCTAAAGAAGTGTTGAGTTTTGATGATGATGAAAAAGAA
GAAAAAAATATAGTTGAAATCAAAACCCAAGAAAAGACTGAGTTTGTTAAGAAAGTTGAG
AAGATTTTTGAAGAGAAAAAAGGCTCGATTTTCCAAGAGCTTAATGATGAAGATTAG