Identifiers and Description

Gene Model Identifier

SteCoe_29520

Standard Name

None

Aliases

None

Description

Abhydro_lipase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007010203.0144087850653746e-40ab-hydrolase associated lipase
region family protein; Steryl
ester hydrolase, similar to y
east TGL1, YEH1 and YEH2 stery
l ester hydrolases
Oxytricha TrifallaxContig11487.0.g498.985825944049381e-37Partial alpha/beta-hydrolase l
ipase region

WormBaseWBGene000100622.4426007377405277e-36
Saccharomyces CerevisiaeYKL140W0.000000000000012664165549094176Steryl ester hydrolase; one of
three gene products (Yeh1p, Y
eh2p, Tgl1p) responsible for s
teryl ester hydrolase activity
and involved in sterol homeos
tasis; localized to lipid part
icle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29520(Protein)
MFVLTILTVLGLSQAVVNPDALRTFAEVCSAHGYGFEAHNVTTEDGYILTLYRIPAKKDQ
PITPGKPVVFLQHGLIDLADTWIMNEPCPGFLFSDAGYDVWFGNSRGSYHSLGHIKYNYK
TDPQYWQFTWQDMADYDIPAVIPFVLQQTGQKKLTYVGHSQGTLQMFAHLSTDPTFINNL
SLFIALAPIGTVRHLDITMFKIIKEIPLMAALEDLGVYEFLPNHHDNLLFYEICSHFGSV
CDDLIGFFADMQVANDNTERFPVILAHEPGGTSTLNMEHWQQMVDYRVNKVQKFNYGKEG
NLNHYGLPDPPYYDYTQIPGPIAIFSGNDDRLADPTDVQWLETTIPASSIVYKNELNGFG
HLTFMWGNPTVMAYFSQVIGLANQYQNNNPTS


>SteCoe_29520(CDS)
ATGTTTGTATTGACTATACTTACTGTTCTAGGACTATCCCAAGCTGTTGTGAACCCTGAT
GCTCTAAGAACATTTGCTGAGGTCTGTTCAGCTCATGGTTATGGTTTTGAGGCTCATAAT
GTTACAACTGAGGATGGATACATCTTAACCTTATACAGAATCCCAGCAAAAAAAGATCAA
CCAATCACCCCAGGTAAACCTGTAGTTTTTCTTCAACATGGGCTTATTGATCTTGCTGAC
ACATGGATAATGAATGAACCATGTCCTGGATTCCTATTTTCAGATGCTGGTTACGATGTT
TGGTTTGGGAATTCTAGAGGAAGCTATCATAGTCTTGGTCATATTAAATACAATTACAAA
ACAGATCCACAATATTGGCAGTTTACTTGGCAAGATATGGCTGATTATGATATCCCAGCA
GTAATTCCTTTCGTCCTACAACAAACTGGACAGAAAAAACTCACTTATGTAGGCCATTCC
CAAGGGACCTTACAAATGTTTGCCCATCTTTCTACAGACCCAACTTTTATCAACAATCTT
AGTCTTTTTATAGCTTTAGCCCCAATAGGCACAGTACGTCATTTAGATATAACAATGTTT
AAAATCATCAAAGAAATACCTTTAATGGCCGCTTTAGAAGATCTTGGTGTATATGAATTT
CTACCAAATCATCATGATAATCTTTTGTTTTATGAAATATGTTCACATTTCGGCTCAGTA
TGTGATGATCTTATTGGTTTTTTCGCTGATATGCAAGTTGCTAATGATAACACAGAAAGG
TTCCCTGTAATTCTTGCTCATGAACCTGGTGGGACAAGTACTCTTAATATGGAGCATTGG
CAACAAATGGTTGATTATAGAGTAAATAAAGTACAAAAGTTCAATTATGGTAAAGAAGGG
AATTTAAATCATTATGGACTTCCTGATCCACCTTATTATGATTATACTCAAATACCTGGA
CCTATAGCTATTTTTTCAGGAAATGATGATAGACTAGCTGATCCAACTGATGTTCAATGG
CTTGAGACAACGATACCAGCTTCAAGTATTGTGTATAAGAATGAACTTAATGGATTTGGC
CATCTAACTTTCATGTGGGGCAATCCAACTGTTATGGCTTATTTCTCACAAGTTATTGGT
CTTGCTAATCAGTACCAAAATAATAACCCAACTAGTTAA