Identifiers and Description

Gene Model Identifier

SteCoe_29543

Standard Name

None

Aliases

None

Description

tRNA_synt_1c_R1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21385.0.g170tRNA synthetases class I (E an
d Q), catalytic domain

WormBaseWBGene000013364.961148436415422e-78
Saccharomyces CerevisiaeYOR168W1.314164668364901e-67Glutamine tRNA synthetase; mon
omeric class I tRNA synthetase
that catalyzes the specific g
lutaminylation of tRNA(Gln); N
-terminal domain proposed to b
e involved in enzyme-tRNA inte
ractions

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29543(Protein)
MIIRRYIRNIMESSTKDLFIRFAGLSAQKADETLKNPQFTQRLLDVIDLAKSNPSFIPTA
DQSKLFYSLASIQKATKPHQELLTNYIISGRLPSVSQLEAAAEYLRSHTEYIVQDLESFA
GIGVTVSEDQLKSTITELIHSEEKKIKEIGWSDKSLVGNLLKRVKVAHKWGNPVQAKEII
EKKLEELIGARPSDEEMKKKKPTTVFDEPVKKEKLSTCIGRELKSAMNSEELMKKHLKFT
EGKVMTRFPPEPNGYLHIGHAKAMRFSFNMASENNGHTYLRFDDTNPDKESEEFIENIKK
NVAWLGYTPWKITHASDYFQEMYDLAVDLIKRGKAYVDEQPWALIKEQRANKIESPYRNT
GIDENIKKFDRMRKGFYAEGEACLRMKIDMSNSNPCMRDPVAYRVKFTPHPHSGDLWCLY
PTYDFEHCIVDSIENITHSLCTLEFEIRRDSYYWLLEALDLYRASVWEYSRLNISQMVMS
KRKLQKLVEEKYVNGWDDPRLPTLNGLRRRGYTADSINEFVDTVGVTRRGNENIININVL
EHCIRKELDEKAPRTMAVVEPLQVNLINFIETKALDIPCYPKNPEKQKYQVNANKTIYIE
KSDFLEQDNQNFFGLSLNKVVGLKYLGFKVKCVKVNKNGQDIESLDCEIVEDNSKPKGVL
HWISDVDAVNCEVRIYDYLFKSLNPAAIDEWISDLNPNSLKILKGAKVHKGLLGANIEDR
FQFERVGYFVVDCDSKGENKVFNRIVTLVETKKKKGN


>SteCoe_29543(CDS)
ATGATTATTCGAAGGTATATAAGAAATATAATGGAAAGCTCTACAAAAGACTTGTTTATT
CGTTTTGCAGGGCTTTCTGCACAAAAAGCTGATGAGACATTAAAGAACCCCCAATTCACT
CAAAGACTCCTCGACGTAATCGATTTAGCAAAAAGCAATCCAAGTTTTATCCCAACAGCT
GACCAAAGCAAGCTTTTTTATAGTTTAGCAAGTATTCAAAAAGCAACAAAACCTCATCAA
GAACTTCTGACAAATTACATAATATCAGGACGACTTCCAAGTGTATCACAATTAGAAGCA
GCAGCTGAATATCTTCGTTCTCATACAGAATATATAGTACAAGACTTAGAATCTTTTGCT
GGTATCGGTGTTACAGTATCTGAAGATCAATTAAAATCAACAATTACTGAACTGATTCAT
TCTGAAGAGAAAAAAATCAAAGAAATCGGCTGGTCTGATAAAAGCTTAGTAGGGAATCTA
TTAAAACGTGTAAAAGTAGCACACAAATGGGGAAATCCAGTACAAGCTAAAGAGATAATT
GAAAAAAAATTAGAAGAGTTAATTGGAGCTAGACCTAGTGATGAAGAAATGAAGAAAAAA
AAACCTACAACGGTATTTGACGAACCAGTTAAAAAAGAAAAACTATCAACTTGTATTGGC
AGAGAACTTAAAAGCGCAATGAACTCAGAAGAACTTATGAAAAAACATTTAAAATTTACT
GAAGGTAAGGTCATGACAAGATTTCCACCAGAACCAAATGGATATTTGCATATTGGTCAT
GCTAAAGCTATGAGATTCAGTTTTAACATGGCATCAGAAAACAATGGGCATACTTATTTA
CGTTTTGATGACACAAATCCTGATAAAGAATCTGAAGAGTTTATAGAAAACATAAAAAAA
AATGTTGCTTGGCTTGGATATACCCCATGGAAAATTACCCACGCTTCAGATTATTTTCAA
GAAATGTACGATTTAGCTGTAGATCTTATAAAAAGAGGAAAAGCTTATGTTGATGAACAA
CCTTGGGCACTTATAAAAGAACAAAGGGCAAACAAAATAGAAAGTCCATATAGGAATACA
GGAATTGATGAAAATATAAAGAAATTCGACAGGATGAGAAAAGGATTTTATGCTGAAGGT
GAAGCTTGTTTAAGGATGAAAATTGATATGTCAAACAGTAACCCTTGTATGAGAGATCCT
GTAGCTTATCGAGTAAAATTTACCCCACATCCACATTCAGGAGATTTATGGTGTTTATAT
CCAACATATGATTTTGAGCATTGTATTGTAGATTCTATTGAAAATATTACCCATTCTTTA
TGTACACTTGAATTTGAAATCAGACGTGATTCTTATTATTGGCTTTTAGAAGCACTTGAT
TTATATAGAGCTTCAGTATGGGAGTATTCAAGATTAAACATTTCACAGATGGTCATGTCT
AAAAGAAAACTTCAGAAACTTGTTGAAGAAAAATATGTTAATGGATGGGATGATCCTAGG
CTTCCAACACTTAATGGACTTAGACGTAGAGGGTATACTGCAGATTCTATAAATGAATTT
GTAGATACTGTTGGGGTTACAAGACGTGGAAATGAAAATATTATAAATATAAATGTTTTA
GAACATTGTATTAGAAAGGAACTTGATGAAAAAGCACCAAGGACAATGGCTGTTGTTGAA
CCATTACAAGTAAATCTTATTAATTTTATTGAAACTAAAGCTTTAGATATACCTTGCTAC
CCTAAAAACCCTGAAAAACAAAAATATCAAGTTAATGCTAATAAAACAATTTATATTGAA
AAATCAGACTTTTTAGAACAGGATAATCAGAATTTCTTTGGTCTTAGTTTGAATAAAGTG
GTTGGGTTGAAGTATTTAGGGTTTAAAGTGAAATGTGTGAAAGTTAATAAAAATGGTCAA
GATATTGAAAGTTTGGATTGTGAGATTGTTGAAGATAATTCTAAGCCTAAAGGGGTTTTA
CATTGGATTTCAGATGTGGATGCTGTTAATTGTGAAGTGAGGATTTATGATTATTTGTTT
AAGAGTTTAAACCCTGCGGCTATTGATGAATGGATTAGTGATTTGAATCCTAATTCGCTT
AAGATATTGAAGGGTGCTAAGGTTCATAAAGGATTACTTGGGGCTAATATTGAGGATAGG
TTCCAGTTTGAGAGGGTAGGATATTTTGTTGTTGATTGTGATTCGAAAGGAGAAAATAAG
GTTTTTAATAGAATTGTTACTTTAGTGGAGACTAAGAAAAAGAAGGGTAATTAG