Identifiers and Description

Gene Model Identifier

SteCoe_29630

Standard Name

None

Aliases

None

Description

HhH-GPD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9879.0.0.g141.9792598779469045e-32HhH-GPD superfamily base excis
ion DNA repair protein

WormBaseWBGene000112013.975449735908647e-31
Tetrahymena ThermophilaTTHERM_011061204.359610000063081e-28HhH-GPD superfamily base excis
ion DNA repair protein; simila
r to yeast NTG1, a DNA N-glyco
sylase and apurinic/apyrimidin
ic (AP) lyase involved in base
excision repair; contains an
endonuclease C3 domain and an
Fe-sulfur binding domain
Saccharomyces CerevisiaeYAL015C9.602680054508676e-24DNA N-glycosylase and apurinic
/apyrimidinic (AP) lyase; invo
lved in base excision repair;
acts in both nucleus and mitoc
hondrion; creates a double-str
and break at mtDNA origins tha
t stimulates replication in re
sponse to oxidative stress; re
quired for maintaining mitocho
ndrial genome integrity; NTG1
has a paralog, NTG2, that aros
e from the whole genome duplic
ation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29630(Protein)
MVKKIIRGPTGNKKVKVQWEEAYKKIAKLRDTFTAPVDIEGAATLGEDEDPKVFRFQTLV
GLMLSSQTRDPVTAKKMRYLVDKGLTIESVLDRTQEQLAEDLYGVSFHNNKAKYLRKTAQ
ILKDKFDGDIPSDYKIVSKLPGVGPKMTHLFLQICYDKVEGIAVDTHVHRIANRLGWVKT
KTPIQTMKALEKLLPKEKWSEVNEILVGFGQIICKPIGPQCEKCSANELCPIGRKKIKLD
DE


>SteCoe_29630(CDS)
ATGGTCAAAAAAATTATCAGAGGTCCTACTGGGAATAAGAAAGTTAAGGTACAATGGGAA
GAGGCTTATAAGAAAATAGCGAAACTTAGGGATACATTTACTGCCCCGGTGGATATTGAA
GGGGCTGCAACTTTGGGTGAGGATGAAGATCCGAAAGTGTTTAGATTTCAAACTTTGGTT
GGGCTTATGCTGAGCTCACAAACTCGTGACCCAGTAACTGCGAAGAAAATGCGTTATCTT
GTTGATAAAGGACTTACAATAGAATCTGTTTTAGATAGGACGCAAGAACAACTTGCTGAG
GATTTGTATGGGGTAAGTTTTCATAACAATAAAGCTAAGTATTTAAGGAAAACTGCACAA
ATACTCAAAGATAAATTTGACGGGGATATTCCAAGTGATTATAAAATTGTGTCGAAATTA
CCAGGTGTTGGACCTAAAATGACACATTTGTTTCTTCAGATTTGCTATGATAAAGTTGAA
GGTATTGCTGTTGATACTCATGTTCATAGAATAGCTAATCGATTAGGGTGGGTTAAGACA
AAAACCCCAATACAAACTATGAAAGCTTTAGAAAAACTTTTGCCTAAAGAGAAATGGTCT
GAGGTTAATGAAATACTTGTAGGATTTGGTCAGATAATTTGCAAACCTATAGGGCCACAA
TGTGAAAAGTGCTCGGCAAATGAACTTTGTCCAATAGGGAGAAAGAAAATAAAGCTTGAT
GATGAGTAA